KEGG   Brachyspira intermedia: Bint_2763Help
Entry
Bint_2763         CDS       T01847                                 

Gene name
porA
Definition
pyruvate ferredoxin oxireductase
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
bip  Brachyspira intermedia
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bip01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bip00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bip00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bip00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bip00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bip00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:bip00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:bip00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3125117..3127381)
Genome map
AA seq 754 aa AA seqDB search
MANKYNLAEQENILESGNELAAIAAAQINYHVMGYYPITPSTQIAEYLDEMKANGRHTVC
MIPGDGEHGAAGICYGATTAGGRVFNATSANGLLFAMEQLPVQAGTRFPMVLNVVNRTVS
GPLDIKCDQSDIMMALNTGWIIIMAHTTQMVYDFNILALKIAEKAKLPIIVSSDGFFTSH
QKKKIYLFKNDKDVQDFLGKYTPEVTSVEPGKNPVTIGPYMNEDELTGSKLQLSQALEDS
RAIITEVFEEFASLSGRQYHPIETYNMEGAEVALMLCGSSYETGTLAVDEMRKANPNLKI
GAFAITQIRPFPEKELQKLLANVKVVVVGDRQDSYSGMGGNMSTEIRAALKNDVNNKSSV
VSRVYGLGGTEFTLEKAKELFDLGLKELANPGSVEKHSYLEQYMGHAGVEMKPIHEPLTL
ESQKSGITVTMNEQTHKLDVKVPPLRELTGKAYRYAQGHGACNGCGIFSGINTFMKGIEG
DVVLLVHTGCSMVVTTGYPYSSYRTTYVHNLFQNGAATLSGVVEMYHERKRRGEIQGPED
PTFIMITGDGGHDIGMGPSIGAAIRNHKMIILEYDNEGYMNTGNQLSFSTPLGHRTSTSN
VGKAEVGKQFGHKDVAQIFAGCHIPYIATGCEAYPMDLIKKAAKAQWYANNHGTAFVKLL
ITCPLNWKSPDDMGKDIIKAAVDCCFFPLYEVEHGITTITQMVADDKKLPVTEWLKMMGK
TKHLLKNQEILDKFQKEVDRRWTRIKAMHESPVL
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaaatataatcttgctgaacaagaaaacatacttgaaagtggtaatgaatta
gcagccattgcagccgctcaaatcaattatcacgttatgggttattacccaatcactcca
tctactcaaattgctgagtacttagatgaaatgaaagctaatggaagacacactgtttgc
atgatccctggtgatggtgaacatggtgctgctggtatctgttatggtgctactactgct
ggcggtagagtattcaatgctacttctgctaacggtcttctttttgctatggaacaatta
cctgttcaagcgggaacaagattccctatggtattaaacgttgtaaacagaactgtttct
ggtccattagatattaaatgtgaccaatctgatattatgatggctcttaacactggttgg
atcatcattatggctcatactactcagatggtttacgacttcaatattcttgcattaaaa
attgctgaaaaagctaaacttcctatcatagtttcttctgatggattctttacttctcac
cagaagaaaaaaatatatcttttcaaaaatgataaagatgtacaagacttcttaggtaaa
tatactccagaagttacttcagttgaaccaggaaaaaatcctgttacaattggaccttac
atgaacgaagatgaattaacaggaagtaaattacagctttctcaagctttagaagattct
cgtgctatcattactgaagtattcgaagaatttgcttctctttctggaagacaatatcat
ccaatagaaacttataatatggaaggagctgaagttgctttaatgctttgcggttcttct
tatgaaactggaactttggctgttgatgaaatgagaaaagctaatcctaaccttaaaata
ggtgctttcgctatcactcaaattcgtcctttccctgaaaaagaattacaaaaattatta
gctaatgttaaagtagttgtagtaggtgacagacaagattcatactctggtatgggtggt
aatatgtctactgaaatcagagctgctttgaaaaacgatgtaaacaataaatcttctgtt
gtaagcagagtttatggtcttggcggtactgagtttactcttgaaaaagctaaagaatta
tttgatttaggtttaaaagaattagctaaccctggttctgttgaaaaacattcttactta
gaacaatatatgggtcatgctggtgttgaaatgaaacctatacatgaacctcttacttta
gagagtcaaaaatcaggcatcactgttactatgaatgaacaaactcataaacttgatgtt
aaagttccacctcttagagaattaactggtaaagcttatcgttatgctcaaggacatggt
gcttgtaacggttgtggtatcttctctggtatcaatactttcatgaaaggtattgaaggt
gatgttgttcttttagtacatactggttgttctatggttgttactacaggttatccttac
agctcttacagaactacttatgttcacaacttgttccaaaatggtgctgctactctttct
ggtgttgttgaaatgtatcatgaaagaaaacgcagaggagaaattcaaggacctgaagat
cctactttcataatgattactggtgacggtggtcatgacataggtatgggaccttctatt
ggtgctgctattagaaatcacaaaatgattatattagaatatgataatgaaggatacatg
aacactggtaaccaattatcattctctactccattaggacatagaacttctacttctaac
gttggtaaagctgaagttggtaaacaattcggacacaaagatgttgctcaaatctttgct
ggttgtcatataccttacattgctactggttgtgaagcttatcctatggatttgattaag
aaagctgctaaagctcaatggtatgctaataatcatggtactgcttttgttaaacttctt
atcacttgtccattgaactggaaatctcctgatgatatgggtaaagatattatcaaagct
gctgttgattgctgcttcttcccattatatgaggttgaacatggtatcactactatcact
caaatggtagctgatgataagaaattacctgttactgaatggttgaaaatgatgggtaaa
actaaacaccttcttaaaaatcaagagatacttgataaattccaaaaagaagttgacaga
agatggactagaatcaaagctatgcatgaaagtcctgttctataa

DBGET integrated database retrieval system