KEGG   Brachyspira intermedia: Bint_2764Help
Entry
Bint_2764         CDS       T01847                                 

Gene name
porG
Definition
(GenBank) pyruvate oxireductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bip  Brachyspira intermedia
Pathway
bip00010  Glycolysis / Gluconeogenesis
bip00020  Citrate cycle (TCA cycle)
bip00620  Pyruvate metabolism
bip00640  Propanoate metabolism
bip00650  Butanoate metabolism
bip00680  Methane metabolism
bip01100  Metabolic pathways
bip01120  Microbial metabolism in diverse environments
bip01130  Biosynthesis of antibiotics
bip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bint_2764 (porG)
   00020 Citrate cycle (TCA cycle)
    Bint_2764 (porG)
   00620 Pyruvate metabolism
    Bint_2764 (porG)
   00640 Propanoate metabolism
    Bint_2764 (porG)
   00650 Butanoate metabolism
    Bint_2764 (porG)
  Energy metabolism
   00680 Methane metabolism
    Bint_2764 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bint_2764 (porG)
Enzymes [BR:bip01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bint_2764 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_6 Fer4_7 Fer4 Fer4_2 Fer4_9 Fer4_21 Fer4_10 Fer4_17 Fer4_8 Fer4_4 BRCT Fer4_16 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEM23358
UniProt: G0EQR2
Position
complement(3127396..3128364)
Genome map
AA seq 322 aa AA seqDB search
MGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKSFVRFSDTEVRVNSTVEEPHVV
AVFHMNLLKNPMTLAGVKEDAIVIFNTNKTPDEARDFAKLHGGKVVCVDAIKIANDLKLP
SQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFSGKKPELVEPNVEAFRRGGSDSVVKDFP
ADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDLQVTRTGNIPVFNPKNCIDCAN
CEVVCPDLCIVWEKGPDRKDPNKIAMNMMGIDYQYCKGCLKCVRACPKGPYSGKFEKDQQ
ALRIEVEADCNVDELTYSRYKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctaatagtgctggtaaaatgcttgcagaagtaggtgttttgactcaaggtttc
tatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagttaaatctttc
gtaagattttctgatacagaagtaagagttaactctacagtagaagagcctcatgttgtg
gctgtattccatatgaatcttcttaaaaaccctatgacattagctggtgttaaagaagat
gctatagttatttttaacactaataaaacacctgatgaagcaagagacttcgctaaatta
catggtggtaaagtagtttgtgttgatgctattaaaatcgctaatgatttaaaacttcct
tcacaagcagctaacactatcattatgggtgctatggttaatcagcttgactttatagat
tctgctaaatttgaagagcaaattagaaagcaattctcaggcaaaaaacctgaattagta
gaacctaacgttgaagctttcagaagaggcggaagtgattctgtagtaaaagatttccct
gcagatggtaaatatccatatataccttacaaaaaaccagaacctgtttatggtaaaaac
aaccaattaacaggtggttatatcaatgctgctggtaactctactttaaaagatttacaa
gttactcgtacaggtaatataccagtattcaatcctaaaaactgtatagactgtgctaac
tgtgaagttgtttgtccagacctttgtatcgtttgggaaaaaggaccagacagaaaagat
ccaaacaaaatagctatgaacatgatgggtattgattatcaatattgtaaaggctgctta
aaatgtgttagagcttgccctaaaggaccttattcaggtaagtttgaaaaagatcagcag
gctttaagaatagaagtagaagctgattgcaatgttgatgaacttacatacagtcgttat
aaaaaataa

DBGET integrated database retrieval system