KEGG   Brachyspira intermedia: Bint_2764Help
Entry
Bint_2764         CDS       T01847                                 

Gene name
porG
Definition
(GenBank) pyruvate oxireductase
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bip  Brachyspira intermedia
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bint_2764 (porG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bint_2764 (porG)
   00020 Citrate cycle (TCA cycle)
    Bint_2764 (porG)
   00620 Pyruvate metabolism
    Bint_2764 (porG)
   00640 Propanoate metabolism
    Bint_2764 (porG)
   00650 Butanoate metabolism
    Bint_2764 (porG)
  Energy metabolism
   00680 Methane metabolism
    Bint_2764 (porG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bint_2764 (porG)
Enzymes [BR:bip01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bint_2764 (porG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3127396..3128364)
Genome map
AA seq 322 aa AA seqDB search
MGANSAGKMLAEVGVLTQGFYGAAFSSYGSEKKGSPVKSFVRFSDTEVRVNSTVEEPHVV
AVFHMNLLKNPMTLAGVKEDAIVIFNTNKTPDEARDFAKLHGGKVVCVDAIKIANDLKLP
SQAANTIIMGAMVNQLDFIDSAKFEEQIRKQFSGKKPELVEPNVEAFRRGGSDSVVKDFP
ADGKYPYIPYKKPEPVYGKNNQLTGGYINAAGNSTLKDLQVTRTGNIPVFNPKNCIDCAN
CEVVCPDLCIVWEKGPDRKDPNKIAMNMMGIDYQYCKGCLKCVRACPKGPYSGKFEKDQQ
ALRIEVEADCNVDELTYSRYKK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctaatagtgctggtaaaatgcttgcagaagtaggtgttttgactcaaggtttc
tatggtgctgcattctcaagttatggttcagaaaagaaaggttctccagttaaatctttc
gtaagattttctgatacagaagtaagagttaactctacagtagaagagcctcatgttgtg
gctgtattccatatgaatcttcttaaaaaccctatgacattagctggtgttaaagaagat
gctatagttatttttaacactaataaaacacctgatgaagcaagagacttcgctaaatta
catggtggtaaagtagtttgtgttgatgctattaaaatcgctaatgatttaaaacttcct
tcacaagcagctaacactatcattatgggtgctatggttaatcagcttgactttatagat
tctgctaaatttgaagagcaaattagaaagcaattctcaggcaaaaaacctgaattagta
gaacctaacgttgaagctttcagaagaggcggaagtgattctgtagtaaaagatttccct
gcagatggtaaatatccatatataccttacaaaaaaccagaacctgtttatggtaaaaac
aaccaattaacaggtggttatatcaatgctgctggtaactctactttaaaagatttacaa
gttactcgtacaggtaatataccagtattcaatcctaaaaactgtatagactgtgctaac
tgtgaagttgtttgtccagacctttgtatcgtttgggaaaaaggaccagacagaaaagat
ccaaacaaaatagctatgaacatgatgggtattgattatcaatattgtaaaggctgctta
aaatgtgttagagcttgccctaaaggaccttattcaggtaagtttgaaaaagatcagcag
gctttaagaatagaagtagaagctgattgcaatgttgatgaacttacatacagtcgttat
aaaaaataa

DBGET integrated database retrieval system