KEGG   Bos indicus (zebu cattle): 109561633Help
Entry
109561633         CDS       T04792                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  
insulin receptor [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adherens junction
Insulin signaling pathway
Ovarian steroidogenesis
Regulation of lipolysis in adipocytes
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Aldosterone-regulated sodium reabsorption
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:biu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    109561633 (INSR)
   04015 Rap1 signaling pathway
    109561633 (INSR)
   04010 MAPK signaling pathway
    109561633 (INSR)
   04066 HIF-1 signaling pathway
    109561633 (INSR)
   04068 FoxO signaling pathway
    109561633 (INSR)
   04072 Phospholipase D signaling pathway
    109561633 (INSR)
   04022 cGMP - PKG signaling pathway
    109561633 (INSR)
   04151 PI3K-Akt signaling pathway
    109561633 (INSR)
   04152 AMPK signaling pathway
    109561633 (INSR)
   04150 mTOR signaling pathway
    109561633 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    109561633 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    109561633 (INSR)
   04923 Regulation of lipolysis in adipocyte
    109561633 (INSR)
   04913 Ovarian Steroidogenesis
    109561633 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109561633 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    109561633 (INSR)
   04213 Longevity regulating pathway - multiple species
    109561633 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    109561633 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109561633 (INSR)
   04931 Insulin resistance
    109561633 (INSR)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109561633 (INSR)
Protein kinases [BR:biu01001]
 Tyrosine protein kinases
  InsR family [OT]
   109561633 (INSR)
Enzyme-linked receptors [BR:biu01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   109561633 (INSR)
Cytokine receptors [BR:biu04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   109561633 (INSR)
CD molecules [BR:biu04090]
 Proteins
  109561633 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
7
AA seq 914 aa AA seqDB search
MEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWEPYWPPDFRDLL
GFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPGWLMRGLKPWTQ
YAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDP
NGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKHNQSEYEESAGE
CCSCPKTDSQILKELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDARPSRKRRALGDVG
NVTAAVPTALGLPNTSSTSTPMSSEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQD
SPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSY
RRYGEEELHLCVSRRHYALERGCRLRGLLPGNYSVRVRATSLAGNGSWTEATYFYVTDYL
DVPSNIAKIIIGPLIFVFLFSVVIGSICLFLRKRQPDGPLGPLYASSNPEYLSASDVFPC
SVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRER
IEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGR
PPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETD
YYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKF
VMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPSFPEVSFFHSEE
NKAPESEELEMEFEDMESVPLDRASHAQREEAGGRDGGSALGLKRNYDEHIPYTHMNGGK
KNGRILTLPRSNPS
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagtttcaggaaccaaggggcgccaggagagaaatgacattgctctaaagacc
aatggggaccaggcatcctgtgaaaatgaattacttaaattttcttacattcggacatct
tacgacaagatcttgctgaaatgggagccgtattggcctcctgacttccgagacctcctg
gggttcatgttgttctacaaagaggccccttaccagaacgtgacagaattcgatgggcag
gatgcgtgcggctccaacagctggacagtggtggatattgacccgcctacgaggtccaac
gaccccaagtcacagaaccaccctgggtggctgatgcgtggtctcaagccctggacccag
tatgccatctttgtcaagaccctggtcaccttttctgatgaacgccgtacatacggggcc
aagagtgacatcatctatgtccagacagacgccactaatccttccgtgcccctggatccc
atctcagtttctaattcctcgtcccagattattctgaagtggaagcctccctccgacccc
aatggcaatatcacacactacttggtgttctgggagagacaggcggaagacagtgagctg
tatgaactggattattgcctcaaagggttgaagctgccctcccggacctggtctccacca
ttcgagtcggagggctcccagaagcacaaccagagtgagtatgaggagtctgctggcgaa
tgctgctcctgcccaaagaccgactcgcagatcctcaaggagctggaggagtcctcgttc
aggaaaacgtttgaagattacctgcacaacgtggttttcatccccagaaaatcatcttca
ggccctgttgccgaggacgctaggccttcgaggaaacgcagagcccttggtgaygtgggg
aatgtgacagcagccgtgcccaccgctctggggctccccaatacctcctccaccagcacg
cccatgagctcggaggagcacagacccttcgagaaagtggtgaacaaggagtcgctggtc
atctccggcctgcgtcactttactggctatcgcatcgagcttcaggcctgcaaccaagat
tcccccgaggagaggtgtagcgtggctgcctatgtcagcgccaggacgatgcctgaagcc
aaggcagatgatattgtcggccccgtgacccatgaaatcttcgagaacaacgttgttcac
ttgatgtggcaggagcccaaggaacccaacggtctgattgtgctgtatgaagtgagttac
cgacgatacggcgaggaggagctgcacctctgcgtctcccgccgacattatgctctggag
cgtggctgccggctgcgtgggctgctgcctgggaattacagtgtgcgagttcgggccacc
tccctggcaggcaatgggtcttggacggaagccacctatttctacgtgacagactattta
gacgtgccatcaaatattgcaaaaatcatcatcggtcccctcatctttgtctttctcttc
agtgttgtgattggaagtatttgtctattcctgagaaagaggcagccagatgggccattg
ggaccactgtatgcttcttcaaacccagagtacctcagtgccagcgatgtgtttccatgc
tctgtgtatgtgccggacgagtgggaggtgcctcgagagaagatcacactcctgcgagaa
ttggggcaaggctcctttggcatggtgtacgagggcaacgccagggacattgtcaagggt
gaggcggagacgcgcgtggcagtgaagacggtcaacgagtcagccagcctgcgagagcgg
atcgagtttctcaacgaggcttcggtcatgaagggcttcacctgccaccatgtggtccgc
ctcctgggggtggtgtccaaaggccagccaacgctggtggtgatggagttgatggctcac
ggagacctgaagagttacctccgttccctgcggcctgaggctgagaataaccccggccgc
cctccgcctaccctgcaagaaatgattcagatggcggcagagatcgccgatgggatggca
tacctgaacgctaagaagttcgtgcaccgggatcttgcagcccggaactgcatggttgcc
cacgactttacagtcaaaattggagactttggaatgacaagagacatctatgaaacggat
tactaccggaaagggggcaaaggtctgctccccgtgcggtggatggcacctgaatccctg
aaggacggagtcttcaccacctcttcagacatgtggtcttttggtgtggtcctttgggaa
attaccagcttggcagaacagccttaccaaggtctatcaaatgagcaggtgctgaaattt
gtcatggatggagggtacctggatcaacctgacaattgtccagagagagtcaccgacctg
atgcggatgtgctggcagttcaaccccaagatgcgtccaaccttcctggagatcgtggac
ctgctcaaggacgacctgcaccccagctttcccgaagtgtccttcttccacagcgaggag
aacaaggcgcccgagagcgaggagctggaaatggagtttgaggacatggagagcgtgccc
ctggaccgggcctcgcacgcgcagagagaggaggccgggggccgggatggagggtcggcg
ctggggctaaagcgaaactatgacgagcacatcccctacacccacatgaacgggggcaag
aaaaacggacggattctgactttgccccggtcaaatccttcctaa

DBGET integrated database retrieval system