KEGG   Bos indicus (zebu cattle): 109568063Help
Entry
109568063         CDS       T04792                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12 isoform X1
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
biu  Bos indicus (zebu cattle)
Brite
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109568063 (ABHD12)
Peptidases [BR:biu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109568063 (ABHD12)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109568063 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
13
AA seq 466 aa AA seqDB search
MICQGCVPSVSPAGSSPGGCGGGGGGGAGEGGRRTPQGLALLRDACCAHGPGKRGRRTAC
VGAARILELPTRRWRTLVQTSFLALPAGSLGPCPEPHPQLAHIFAFLRVEGSPLPEPERV
CPSGGGSSVIRWRKGLCFRLRKILFFVLGLYVAIPFLIKLCPGIQAKLIFLNFVRVPYFI
DLKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPTVWWKNAQGKDQMWYEDALSSSHPIIL
YLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIK
VRSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYR
YFPGFDWFFLDPITSSGIQFANDENVKHISCSLLILHAEDDPVVPFQLGRKLYNIAAPSR
SFRDFKVQFIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPGRQH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgatttgccagggatgcgttccatcagtgtcgcccgcaggctcttctccgggcggctgc
ggcggtggcggcggaggcggagctggtgaaggcggtcggcggactcctcaggggcttgct
cttctccgggacgcatgttgtgcccacggcccggggaagcgcggccggaggacggcgtgc
gtcggcgctgcgcgcatcctggagctcccgaccaggaggtggaggacattggtccagaca
tcgttcctagctctccctgcgggctccttggggccctgccctgagccgcacccgcagctc
gctcacatctttgccttcctgcgggtggaaggaagccctctcccggaacctgagcgtgtg
tgcccctctggaggagggtcgtcagtgatccgctggcgaaagggcctgtgcttccgactg
aggaagatactcttctttgtcctgggattgtatgtggccattccatttctcatcaaacta
tgtcctgggatacaggccaaactgattttcttgaatttcgtgcgggttccctatttcatt
gatttgaaaagaccacaggatcaaggtttgaatcacacctgtaattactacctccagcca
gaggaagacgtaaccattggagtctggcacacggtccccactgtctggtggaagaatgcc
caggggaaggaccagatgtggtacgaggatgccctgtcttccagccacccgatcatcctg
tacctgcatgggaacgcgggcaccagaggcggcgaccaccgggtggagctttacaaggtg
ctgagttccctcggctaccacgtggtcacctttgactacagaggttggggtgactcagta
ggaacgccgtcggagcggggcatgacgtatgatgcactccatgtttttgactggatcaaa
gtgcgaagtggagacaaccctgtgtatatttggggccattctcttggcaccggagtggcc
acaaacctggtgcggcgcctctgtgagcgagagactcctccagatgccctcatcttggaa
tctccattcactaatatccgtgaagaagccaagagccatccgttctcagtgatctatcga
tatttccctgggtttgactggttcttccttgatcccatcacaagcagtggaattcagttt
gcaaatgatgaaaatgtgaagcacatctcctgctccctgctcatcctgcacgccgaggac
gacccggtcgtgcccttccagctcggcagaaagctctacaacatcgccgcaccgtcacgc
agcttccgggactttaaggttcagttcatccccttccactcggaccttggctacaggcac
aagtacatctacaagagccccgagctcccgcggatcctgagggagttcctggggaagtcg
gaaccgggacgccagcactga

DBGET integrated database retrieval system