KEGG   Bos indicus (zebu cattle): 109576149Help
Entry
109576149         CDS       T04792                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
biu  Bos indicus (zebu cattle)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:biu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    109576149 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109576149 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    109576149 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    109576149 (MGLL)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109576149 (MGLL)
Peptidases [BR:biu01002]
 Serine Peptidases
  Family S33
   109576149 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
22
AA seq 313 aa AA seqDB search
MQTAPEDPFRMPEERPPRLTPQNVPYQDLPHLVNADGQHLFCRYWRPLSAPRALVFVSHG
AGEHCGRYDELAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDAVQKD
YPGLPVFLLGHSMGGAICILTAAERPGHFSGMVLISPLVVANPESATLFKVFAAKVLNLV
LPNMSLGRIDSSVLSRNKTEVDIYNTDPLVCRAGLKVCFGNQLLNAVSRVERALPKLTLP
FLLLQGSADRLCNSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWV
SQRTAVEGMGCPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagacagcacctgaagatcctttcagaatgccagaggaacgtccccccaggctgacc
ccgcagaacgttccctaccaggacctccctcacctggtcaacgctgacgggcagcacctc
ttctgccggtactggagacccttgagcgcgcccagggccctggtgttcgtgtcccacgga
gctggcgagcactgcggccgctacgacgagctggcgcagatgctggtrgggctgggcctg
ctggtcttcgcccacgaccatgtcggccaygggcagagcgagggcgagaggatggtggtg
tccgacttccacgtcttcatccgggatgtgctccagcacgtggacgccgtgcagaaggac
tacccggggctgcctgtcttcctcctcggccactccatgggcggcgcgatctgcatcctc
acggccgcggagaggccgggccacttctcgggcatggttctcatttccccgctggtcgtc
gccaatccagagtcggcgacacttttcaaggtcttcgctgcgaaagttctgaacctcgtc
ctgccaaacatgtccctgggccggatcgactccagtgtgctctcgaggaataagacggag
gtggacatctacaacacggaccccctggtctgccgggcgggactcaaagtctgctttggc
aaccagctgctcaacgcggtgtcgcgggtggagcgggcgctgcccaagctgacgctgccc
ttcctgctgctgcagggctctgccgaccgcctctgtaacagcaggggcgcctacctgctc
atggagtcagccaagagccaggacaagacgctcaagatttacgaaggtgcctatcacatc
ctccacaaagagcttcctgaggtgaccagctctgtcttccgggagataaacacgtgggtc
tcgcaaaggacagcggtggagggaatggggtgcccaccctga

DBGET integrated database retrieval system