KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0188Help
Entry
bll0188           CDS       T00109                                 

Definition
shikimate kinase
Orthology
K00891  
shikimate kinase [EC:2.7.1.71]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bll0188
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bll0188
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     bll0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(183178..183912)
Genome map
AA seq 244 aa AA seqDB search
MARVLWRGPLWGRIGGQSRPLLAADRARPRARSRARPMSDAALPIQASPEADILSALGAR
SIVLVGMMGVGKSTIGRRMAARLKLPFVDADTEIEAAAGMTIPEIFERHGEGHFRDGEAR
VIARLLDGGPVVLATGGGAFMREETRARIAAKAVSIWLKADHDVIMRRVRRRADRPLLQT
ADPEGTVTRLLTEREPVYSHADLTIASRDVPHDKIVEECIETLRAHLCGEQAAQPPADVA
SAVR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtggcaagagtcctctggcgaggccccctttggggtcgtataggtggccaaagcaggccg
cttttggcggcagatcgagcgagacccagagcgagatccagagcgagacccatgtccgac
gccgcgttgccgatacaagcatcgcctgaggccgacatcctgtcggcgctcggggcgcgc
tcgatcgtgctcgtcggcatgatgggggtgggtaaatccaccatcggccgccgcatggcg
gcccggctcaagctgcccttcgtcgacgcggacaccgagatcgaggcggcggccggcatg
accataccggagattttcgagcgccatggcgagggccatttccgcgacggcgaggcccgc
gtgatcgcgcgcctgctcgacggcggcccggtggtgctggcgaccggcggcggcgccttc
atgcgcgaggagacgcgtgcgcgcatcgcggccaaggcggtctcgatctggctcaaggcc
gaccacgacgtcatcatgcgccgcgtccgccgccgcgccgaccgcccgttgctccagacc
gccgaccccgagggaaccgtgacgcgcctgctcaccgagcgcgagccggtctacagccat
gccgacctcaccatcgcctcgcgcgacgtgccgcacgacaagatcgtcgaggagtgtatc
gagacgctgcgcgcccatctctgcggcgaacaggccgcccaaccacctgccgacgttgcg
agtgccgtacgatga

DBGET integrated database retrieval system