KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0459Help
Entry
bll0459           CDS       T00109                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    bll0459
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     bll0459
   3.1.2  Thioester hydrolases
    3.1.2.-  
     bll0459
Lipid biosynthesis proteins [BR:bja01004]
 Fatty acid synthase
  Component type
   bll0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(497448..498206)
Genome map
AA seq 252 aa AA seqDB search
MAMVSGVVPASEEDSMRVSMVRSYGNSDSAVERRYGLFMHIAVLMLAVMTIATNASAQAQ
PAAQPIKLVVLGDSLSAGLGLPAQEAFPTKLQKALQTKGIEVGMTNAGVSGDTASGGRDR
LDWSVPEGTEGVIVELGANDALRGIDPGLTRAALTDIVQRLKARGIPVMLCGMLAPPNYG
ADYAARFNSIYPDLAKQFDVPLYPFFLDGVAADAKLNQADGIHPTAAGVDIIVGNMMPTV
EAFLRNISEQRR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggtgtccggcgtggtgccggcgagcgaagaggattcgatgcgagtgtccatg
gtccggtcatatggcaactccgatagcgcggtcgagaggcgttacggattgttcatgcac
atagccgtgttgatgctcgccgtgatgacaattgcgacaaatgcgtcggcacaggcccag
ccggccgcccaaccgatcaagctggtggtcctcggcgattccttgagcgccggcctcggc
ctcccggcacaggaggcattccccacgaaacttcaaaaagccttgcagaccaaaggcata
gaggtcggcatgaccaatgccggggtgtccggcgacaccgcctccggcggccgcgaccgg
ctcgactggtcggtgcccgagggaaccgagggggtgatcgtcgagctcggcgccaacgac
gcgctgcgcggcatcgatcccggcctgacgcgcgccgcgctgaccgacatcgtccagcgg
ctgaaggcacgcgggattccagtcatgctgtgcggcatgctggcgccgccgaattacggt
gccgactacgccgcgcgcttcaattcgatttatccggatcttgcgaaacaattcgacgtg
ccgctctatccgttctttctcgacggcgttgcggccgacgccaagctcaaccaggccgac
ggcatccacccgaccgcggcgggcgtcgacatcatcgtcggcaacatgatgcccacggtg
gaggcattcctgcgcaacataagcgagcaacgccgttga

DBGET integrated database retrieval system