KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0566Help
Entry
bll0566           CDS       T00109                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    bll0566
Enzymes [BR:bja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     bll0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(607185..607931)
Genome map
AA seq 248 aa AA seqDB search
MSILVTRPHPDNEATADNLRARGHVVLLAPVLKFEPVAFHDESEANYSAIIVTSANAIRA
VAPQLQDLGLLKLPLFAVGEHTATAARDAGFAEVIIAGGDSAALRDTVVRSARDKVLKKK
STLLYLAGADLSRDLGGELGTEGFNVVTQTTYRMAPVKVLPRDVCEGFAAHGIEAVLHYS
RRSARAFLDAARDEGVEISALAIPQCCLSETVASVLRDAGASQVLVAAKPDENALFDTLE
RALQTRLA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcttgtcacacggccgcatcccgacaatgaggcgacggcggacaatttgcgc
gcgcggggacacgtggtgctgctcgcgccggtgctcaaattcgagccggtcgctttccac
gacgagagcgaggcgaactatagcgccatcatcgtcacatcggccaatgcgatccgtgcc
gtcgcgccgcaattgcaggatctcggcctgttgaagctgccgctgttcgcggtcggcgag
cacaccgcgactgccgcgcgagacgccggctttgccgaggtgattatcgccggcggcgat
tccgcggccctgcgcgacacggtcgtccggagtgcgcgcgacaaggtgctgaaaaagaaa
agcacgctgctttatctcgccggcgcggatctgtcgcgcgatctcggcggcgaactcggc
accgaaggcttcaacgtggtgacgcagaccacctatcgcatggcgccggtcaaggttctc
ccgcgcgatgtctgcgagggttttgccgcgcatgggatcgaggcggtgcttcattactcc
cggcgcagcgcgcgagccttcctggatgcagcgcgggacgaaggcgtcgaaatctcggcg
ctggcgatcccgcaatgctgcctgtccgagacggtcgcaagcgtgctgcgcgatgccggt
gcgtcgcaggttctggtggccgcgaaaccggacgaaaatgccttatttgacaccttggag
cgtgctttgcagacccgtttggcgtaa

DBGET integrated database retrieval system