KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0677Help
Entry
bll0677           CDS       T00109                                 

Gene name
pncA
Definition
(RefSeq) bifunctional pyrazinamidase/nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00760  Nicotinate and nicotinamide metabolism
bja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    bll0677 (pncA)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     bll0677 (pncA)
    3.5.1.-  
     bll0677 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 1049268
NCBI-ProteinID: NP_767317
RhizoBase: bll0677
UniProt: H7C7U0
Position
complement(722742..723464)
Genome map
AA seq 240 aa AA seqDB search
MLDRRQVLAALGTSALVALAPTALLAAASIKPDDASALLVIDVQNCFLPGGSLAVKEGEQ
VVPVINKISKAFSNVVMTQDWHTPGHVSFASVHSGKKPFETIDLPYGKQVLWPDHCVQGT
DGASLSKDLAIPHAELIIRKGFHKDVDSYSAFLEADGKTSTGLAGYLKGRKIKRVFVAGL
ATDFCVAWTALDARKAGFEVYVVEDACRGIDTQGSLAKAWADMAKAGVKRIQSADIAASA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgctagatcggcggcaagtcttggcggcgcttgggacgagcgccctcgtagccctcgcg
ccaaccgcacttcttgcggccgcatcgatcaagccggacgatgcgtccgcgctgctcgtg
atcgacgtgcagaactgcttcctgccgggcggcagcctcgcggtgaaggaaggcgagcag
gtggtgcccgtcatcaacaagatctcgaaagcgttttcgaatgtggtgatgacgcaggac
tggcacacgcccggtcacgtttcgtttgcgtcggtccactccggcaagaagccgttcgag
accatcgacctgccgtacggcaagcaggtgctgtggcccgaccattgcgtgcagggcact
gacggcgcttcgctgtcgaaggacctcgcaatcccgcacgccgagctcatcatccgcaag
ggttttcacaaggacgtcgacagctattcggccttcctcgaagccgacggcaagacttcg
accggcctcgccggctatttgaagggccgcaagatcaagcgcgtctttgtcgctggcctc
gcgacagatttctgcgtcgcctggaccgcgctcgacgcgcgcaaggcgggcttcgaagtc
tatgtcgtggaagacgcctgccgcggcatcgacacgcagggctcgctggcaaaagcctgg
gccgacatggccaaggccggcgtgaagcggattcagtcggcggatatcgcggcgagcgcg
taa

DBGET integrated database retrieval system