KEGG   Bradyrhizobium japonicum USDA110: bll0902Help
Entry
bll0902           CDS       T00109                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bja00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(982050..983747)
Genome map
AA seq 565 aa AA seqDB search
MIDDLWYKNGVIYCLSVGTYMDADGDGVGDFKGLLRRLDYLHGLGITTIWLMPFQTSPGR
DDGYDIADYYSVDSRYGTLGDFVEFAHGCKQRGIRIIIDLVVNHTSDQHRWFKDARRDKN
SPYRDWYVWSDTKPANANKGMVFPGVQKSTWTRDKDAGAWYFHRFYDFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIATKGAKVKKPVEQYDMLRAFREFLQWRQGDAII
LAEANVLPETDMEYFGRDADRMHMMFNFHVNQHLFYALASADSRPLAKALKATKPRPGSA
QWGLFLRNHDELDLGRLTPAQRDTVFKSFGPDKDMQLYDRGIRRRLAPMLGGDRRRLELA
YSLMCTLPGTPVIRYGDEIGMGDDLSLPERNCARTPMQWSTEPHGGFTKNDKPACPVIDK
GPYGFPHVNVAKQRRDANSMLNWTERIVRMRKEVPEIGWGDFAVIATRDPAVFIMRYDWR
NNSVLFVHNLDEKPREIAFSTGLPDDAGAHLINLLAEDHSHADKRGQHRVVLEPYGYRWY
RVGGLDYLLKRSDIDGDTAGNKHPG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgatctctggtacaagaacggcgtgatctactgcctgtccgtcggcacctat
atggatgccgacggcgacggcgtcggcgacttcaagggcctgctgcggcggctcgactat
ctgcacggcctcggcatcaccacgatctggctgatgccattccagacctcgcccggccgc
gacgacggctacgacatcgccgactattacagcgtcgattcccgctacggcacgctcggc
gacttcgtcgaattcgcccatggctgcaagcagcgcggcatccgcatcatcatcgacctc
gtcgtcaaccacacctcggaccagcatcgctggttcaaggacgcgcggcgcgacaagaac
tcgccctatcgcgactggtacgtctggtccgacacgaagcccgccaatgccaacaagggc
atggtgtttcccggcgtgcagaaatcgacctggacgcgcgacaaggacgccggcgcctgg
tattttcatcgcttctacgattttcagcccgacctcaacacctcgaacccgcacgtgcag
gccgagatcttgaagatcatgggcttctggatccagctcggcgtctccggattccgcatg
gacgccgtgcccttcgtgatcgcgaccaagggcgccaaggtgaagaagccggtcgagcaa
tacgacatgctgcgcgcgttccgcgaattcctgcaatggcgccagggtgacgccatcatc
ctcgccgaagccaatgtgctgccggaaaccgacatggaatatttcggccgcgatgccgac
cgcatgcacatgatgttcaacttccacgtcaaccagcatctgttctatgcgctggcgtcg
gccgactcgcgaccgctggcaaaggcgctgaaggcgaccaagccgcggccgggctcggcg
caatggggcctgttcctgcgcaatcacgacgagctcgatctcgggcgcttgaccccggcg
cagcgcgacaccgtgttcaagagcttcggccccgacaaggacatgcagctctacgaccgc
ggcattcgccgccgcctcgcgccgatgctcggcggcgaccgcaggcggctcgagcttgcc
tacagcctgatgtgcacgctgccgggaacgcccgtgatccgctatggcgacgagatcggg
atgggcgacgatctctcattgccggagcgcaattgcgcgcgcacgccgatgcaatggtcg
accgagccgcatggcggcttcaccaagaacgacaagccggcctgtcccgtcatcgacaag
ggcccttatggctttccgcacgtcaacgtcgccaagcagcggcgcgatgccaattccatg
ctgaactggaccgaacgcatcgtccgcatgcgcaaggaggtgccggagatcggctggggc
gatttcgcggtcattgcgacgcgtgatccggccgtcttcatcatgcgctatgactggcgc
aacaattcggtgctgttcgtgcacaatctcgatgagaagccacgcgagatcgcgttctcg
acggggctgcctgatgatgccggcgcgcacctgatcaatctgctcgcggaagaccacagc
cacgccgacaagcgcggccagcaccgcgtcgtgctggagccgtatggctatcgctggtat
cgggtcggcgggttggattatctcttgaagcggagcgatatcgacggggatactgcgggt
aacaagcatccggggtag

DBGET integrated database retrieval system