KEGG   Bradyrhizobium diazoefficiens USDA 110: bll0975Help
Entry
bll0975           CDS       T00109                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K09181  
hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1069221..1071440)
Genome map
AA seq 739 aa AA seqDB search
MEARVSAAFSSPRPWSPSPDASDIVKGIHAMLHPHNIVLVGATDKPGNYAERIWNNLVKY
GFEGGLYPVNAKRETIWGVPCYKDFAALPEKPDHVLVLVPARFAVQVIRDAAAAGARSAT
IVTSGFSELQDDESQQLAAELQAAIRETGLAVTGPNCLGNLSAGEKLFTNIDDRIVTMEQ
GAVAIAGQSGAIVMAIRQALEDRGVGVGYMVTTGNEAGLETPDLMRYFAEDPSVKVIVVY
LEGVRNTKAFRDACKAARAASKPVIALKLGASEGGRAAAMAHTGALAGSIETFDAIATRE
GVIRVGGLDELIETTECFVHAAVPNGDRLAAVTLSGGKRGMLIDAFYAEGLNFAPLSPHV
SSELARMLGPGSIVGNPLDAGFAAVVDPSVYMKSIKLMIDDPDIDIVIIDAELPKAPHEL
RERNLRIVDEMASRASKPVIYISAMSIGFTEFTKSLRKSLPHLAVMQGMDRAVTAIKSLL
AYAKLRKEVPDIVSSSKPAARAVLEKALTSANGAALDEVASKKLLKAYGIPTSKEATAQT
AAEAVKIAKQIGFPVVAKVVSAEILHKSDIGGVVLNLSNAAEVKKAFADITARVKRLKGK
PRLDGILIAQQVKADLELVVGASLDAEMGPVVLFGTGGIDIELMKDVALAGAPLDEAEAR
LLIGRTKAGIKMRGYRGKPALHEASAVKALVGLSNLIADAGDRIASIDINPFLINTRTGV
AVDALIVLNNAAAKRAAGH
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcgcgtatctgctgcattctcctctccgcgcccatggtctccatcgcccgac
gccagcgacatcgtaaaaggcatccatgccatgctgcacccgcacaacatcgtgctggtg
ggcgcgaccgacaagcccggcaattatgccgagcgcatctggaacaatctggtcaaatac
ggcttcgagggcgggctctatccggtcaacgccaagcgcgagacgatctggggtgtgccc
tgctacaaggattttgcagccctcccggaaaagcccgatcatgtcctggtgctggtgccg
gcgcgtttcgccgtgcaggtgatccgcgatgccgccgcggccggcgcgcgctcggccacc
atcgtcacctccggcttcagcgagttgcaggatgacgagagccagcagctcgccgccgaa
ctgcaagcggccatccgcgaaaccggcctcgccgtcaccggcccgaattgcctcggcaac
ttgagcgccggcgaaaagctcttcaccaatatcgacgaccgcatcgtcaccatggagcag
ggcgcggtggcgatcgccgggcaatccggcgccatcgtcatggcgatccgccaggcgctg
gaggatcgcggtgtcggtgtcggctacatggtgacgaccggcaacgaggccgggctcgag
acgccggacctgatgcgttatttcgcggaggatccgagcgtcaaggtgatcgtggtctac
ctcgagggcgtgcgcaacacaaaggcctttcgcgacgcctgcaaggcggcgcgcgcggcg
agcaagcccgtgatcgcgctcaagctcggcgcatccgagggcggccgcgccgcggcgatg
gcgcacaccggagcgctggcgggctcgatcgagacgttcgacgcaatcgcaacgcgtgaa
ggtgttatccgggtcggcgggctcgacgaattgatcgagaccaccgaatgcttcgtccac
gccgccgtacccaacggtgaccggctcgccgcggtcacgctgtccggcggcaagcgcggc
atgctgatcgacgccttctatgcggaaggcttgaacttcgcaccgctcagcccgcatgtc
agctcggagctggcgaggatgcttgggcccggatcgatcgtaggcaatccgcttgacgcc
ggctttgccgcggtcgtcgatccctccgtctacatgaagtcgatcaagctgatgatcgac
gaccccgatatcgacatcgtcatcatcgatgccgagctgccgaaggcgccgcacgagctg
cgcgagcgtaacctgcgcatcgtcgacgagatggcgagccgggcctcaaagcccgtgatc
tacatcagcgcgatgtcgatcggcttcaccgagttcaccaagtccttgcgcaaatcgctg
ccgcatctcgcggtcatgcagggcatggatcgcgcggtcaccgcgatcaaatcactgctc
gcctatgcgaagctacgcaaggaagtacccgacatcgtctcgagctcgaaacccgccgcg
cgtgccgtgctggaaaaggcgctgacatcggcgaacggcgccgcgctcgacgaagtcgcc
tcgaagaagctcctgaaggcctatggcatcccgacctcgaaggaagcgaccgcacagacc
gcggcggaagccgtgaagatcgcgaaacagatcggcttcccggtcgtggcaaaggtcgtc
agcgccgagatcctgcacaagtccgacatcggcggcgtggtgctgaacctgagcaatgcg
gccgaggtgaagaaggcgttcgccgatatcaccgcgcgggtgaagcggctgaagggcaag
ccgaggctcgacggcatcctgatcgcgcagcaggtcaaggccgacctcgaactcgtggtc
ggcgcctcgctcgatgccgagatgggtccggtcgtgctgttcggcaccggcggcatcgac
atcgagctgatgaaggacgtcgcgctcgcgggcgcgccgctcgacgaggccgaggcgcgg
ctcctgatcggccgcaccaaggccggcatcaagatgcgcggctatcgcggcaagccggcc
ttgcacgaggcctccgcggtgaaggcgctggtcggcctgtccaacctgatcgcggatgcc
ggcgaccggatcgcctcgatcgacatcaatccgttcctgatcaacaccaggacgggcgtg
gcggtcgatgccctgatcgtgctgaacaatgccgcggcaaagcgcgcggccgggcattga

DBGET integrated database retrieval system