KEGG   Bradyrhizobium diazoefficiens USDA 110: bll1474Help
Entry
bll1474           CDS       T00109                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bll1474 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bll1474 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    bll1474 (glcB)
Enzymes [BR:bja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     bll1474 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(1605564..1607729)
Genome map
AA seq 721 aa AA seqDB search
MKRVDAHGLKIAPVLFDFIAKEAAPKTGIAPDAFWAGVAAIIKDLGPKNRALLALRDALQ
AKIDDWHRANKGKAFDLNAYTAFLKEIGYLVPEPATQKVETANVDEEIGKICGPQLVVPL
TNARYALNAANARWGSLYDAFYGTDAIPHDPSESGKGYNKARGDKVIAKAKAFLDAAVPL
ATGSHTDVTAYSIVAGQLAVKLKSGNATALKNAAQFAGFQGDAAAPSAVLLVNNGLHVEV
TINRNSAIGKDDPAGVADMVMEAAVSTILDMEDSVAAVDAEDKVLVYRNTLGLMNGTLSA
DFEKGGKTLTRSLNADRSYKTPDGKGEVKLHGRSLLLMRNCGHHMFTDAVLDERGEEVPE
GLLDAAVSGLLAIHDLKGNSKVKNSRTGSAYIVKPKMHGPDEVSFTCEIFDRVEKMLGLP
ENTLKVGIMDEERRTTVNLKACIQRASKRIMFINTGFLDRTGDEIHTSMEAGPMIRKNEM
KAQAWIKAYEDWNVDMGLIDGLPGHAQIGKGMWAAPDKMADMLAQKLAHPQAGATTAWVP
SPTAATLHALHYHQVNVIARQEELTKGGPRAKLSDILTIPVSKSNWAPDDVKQEIDNNCQ
GILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHQGVITEAQVMESLK
RMAVVVDKQNAGDAIYKPMAPAFDGVAFKAACDLIFKGREQPNGYTEYILTARRREAKAA
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgtcgacgcccacggattgaagatcgctcctgttctgtttgacttcatcgcc
aaggaagcggccccgaaaacggggatcgcgccggatgcgttctgggccggggttgccgcc
atcatcaaggaccttgggccgaagaaccgggcgctgctggcgttgcgcgacgcgctacag
gccaagatcgacgactggcatcgcgccaacaagggcaaggcgttcgacctcaatgcctat
accgccttcctgaaggagatcggctatctcgtcccggagccggcgacgcagaaggtcgag
accgccaatgtggacgaggagatcggcaagatctgcggcccgcagctcgtcgtccccctc
accaatgcgcgctatgcgctgaacgcggcgaacgcacgctggggctcgctctatgacgcc
ttctacggcaccgacgcgatcccgcacgatccgtccgagagcggcaagggttacaacaag
gcgcgcggcgacaaagtgatcgcgaaggccaaggccttcctcgacgccgccgtgccgctc
gcgactggcagccacaccgacgtcaccgcctacagcatcgtcgcgggccagctcgcggtg
aagctgaagagcggcaatgcgaccgcgctgaagaacgccgcgcagttcgccggcttccag
ggcgatgcggccgcgccgagcgcggtgctgctcgtcaacaacggcctgcatgtcgaggtg
acgatcaaccgcaacagcgcgatcggcaaggacgatcccgccggcgtcgccgacatggtc
atggaggccgcggtctcgaccattctcgacatggaggactcggttgccgcggtcgacgcc
gaggacaaggtgctggtctaccgcaacacgctcggcctgatgaacggcacgctctcggcc
gacttcgagaagggcggcaagacgctgacccgttcgctcaacgccgaccgcagctacaag
acgccggacggcaagggcgaggtgaaattgcacggccgcagcctgctgctgatgcgcaat
tgcggtcaccacatgtttaccgacgcggtgctggacgaaaggggcgaggaggtcccggag
ggcctgctcgacgccgccgtctccggcctgcttgcgatccacgacctcaagggcaattcg
aaggtcaagaacagccgcacgggatctgcctatatcgtcaagccgaagatgcacggcccg
gacgaggtgtcgttcacgtgcgagattttcgaccgcgtcgagaagatgctcggcctgccg
gagaatacgctcaaggtcggcatcatggacgaggagcggcgcaccaccgtcaacctcaag
gcctgcatccagcgcgcctccaagcgcatcatgttcatcaacaccggcttcctcgaccgc
accggcgacgagatccacacctcgatggaagccggccccatgatccgcaagaacgagatg
aaggcgcaggcctggatcaaggcctacgaggactggaacgtcgacatgggcctgatcgac
ggccttcccggccacgcccagatcggcaagggcatgtgggccgcgcccgacaagatggcg
gacatgcttgcgcagaaactcgcccatccgcaggccggcgccaccaccgcctgggtcccc
tcgccgaccgccgcgacgttgcacgcgctgcactaccaccaggtcaacgtcatcgcgcgc
caggaggagctgaccaagggcggaccgcgcgcgaagctgtccgacatcctcaccattccg
gtgtcgaagtcgaactgggcgcccgacgacgtcaagcaggagatcgacaacaactgccag
ggcatcctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctccaaggtgccc
gacatccacgacgtcggcctgatggaagaccgcgccaccttgcgcatctccagccagcac
ctcgccaactggctgcaccagggcgtgatcaccgaggcgcaggtgatggaatcgctgaag
cgcatggccgtcgtcgtcgacaagcagaacgcgggcgatgccatctacaagccgatggcg
cccgccttcgacggcgtcgctttcaaggccgcctgcgacctgatcttcaagggccgcgag
cagccgaacggctacaccgagtacatcctcaccgcgcgccgccgcgaggcgaaggcggcg
ggctag

DBGET integrated database retrieval system