KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2067Help
Entry
bll2067           CDS       T00109                                 

Gene name
nfeC
Definition
(RefSeq) nodulate formation efficiency C protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2231080..2231907)
Genome map
AA seq 275 aa AA seqDB search
MKRDRPRVMKRMPGRPALWLSVVGFLICLAWPAAMSNNIRASDSPLVERLKSTWRAQDGE
TIEQIISNVSKVAQFVPQMWGVVELGQNDFILVSWTRHRDNKSDEQYVIAWKIALDGTLE
LASTYAKPMELGWRALALSLIASEVADGERDANLRFLHDPANFNFVTTPQGRLGDLLRQG
RCTIIEPVGVDYLPKRNDKPAEKGGVWRVLLLVNCSIQGPRYFTHNGVITFEKREGQDWE
PQSSFAKRIAKFPPGSWFQRTEPKEEEDLGEPRPE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgataggccgagggttatgaagagaatgcctggaagacccgcgctatggctt
agcgtggtcggatttttaatctgcctcgcctggccggctgccatgagcaataatattcgg
gccagcgacagtccccttgtcgaacgactgaagtcaacttggcgagcgcaagatggtgag
acgatagaacaaattatctccaatgtctcgaaggtggcacagttcgtgcctcaaatgtgg
ggcgttgttgaacttggccaaaacgactttattttggtttcgtggaccagacaccgggac
aacaaatcggacgaacagtacgttatcgcctggaagatcgccctcgacggcacgcttgaa
cttgcgtcgacttatgcgaagccgatggaattgggctggcgcgccctggcgctctcccta
atcgccagtgaagtcgcagatggcgaaagggacgcaaatcttcgctttctgcatgatccg
gccaacttcaactttgtgactaccccgcaaggccggctcggcgatcttctgcggcagggc
cgctgcactatcattgaaccagttggagtggactacttaccgaagcggaatgataaaccg
gccgagaagggtggcgtgtggcgcgttctgctcttggtgaattgtagtatccaaggacca
cgttattttacacacaacggggtcatcactttcgagaagagagaaggacaggattgggag
ccacaatcctcctttgccaaacgcatcgcgaaatttccccctggctcctggttccaacgc
accgagccaaaagaagaggaagacttaggagagccaaggcctgagtaa

DBGET integrated database retrieval system