KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2190Help
Entry
bll2190           CDS       T00109                                 

Definition
(RefSeq) 3'(2'),5'-bisphosphate nucleotidase CysQ
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00920  Sulfur metabolism
bja01100  Metabolic pathways
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    bll2190
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     bll2190
Transfer RNA biogenesis [BR:bja03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    bll2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 1055357
NCBI-ProteinID: NP_768830
RhizoBase: bll2190
UniProt: Q89T60
Position
complement(2365217..2366047)
Genome map
AA seq 276 aa AA seqDB search
MQVKRIIDGAAASGLMEPLTALVVKAGEAILAVNRAAMRVDGKQDGSPVTEADLAADRVI
ADGLAQLAGDIPTLSEERTQLAAPPFRDSFFLIDPLDGTKEFVAGRDEFTVNLALVTHGV
PLLGIVSAPALGLLWRGIVGRGAECVRFDGATIGAAEPVHTRKLPAPGEPWVAAVSRSHG
DPKSEAFIDNRPNAVRRTVGSAVKFGRIAEGSADIYPRFGPTSEWDVGAGCAVVTAAGGK
VTDGKGGEILFGQRQDTGFIIPEFIAWGDPQAVDRY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaagcggatcatcgacggcgcggccgcatccggcctgatggagccgctcacc
gcgctggtggtgaaggcgggcgaagcgatcctcgcggtcaaccgcgcggcgatgcgggtc
gacggcaagcaggacggctcgccggtgaccgaggccgaccttgccgccgaccgcgtcatt
gcggacggcctggcgcagctcgcgggcgacatcccgacgctgtcggaggaacggacccag
ctcgccgctccgccgttccgcgacagcttcttcctgatcgatccgctcgacggcaccaag
gagttcgtggccggccgtgacgagttcaccgtcaacctcgccctcgtcactcacggggtg
ccgctgctcggcatcgtcagcgcacccgcactcgggctgctctggcgcggcatcgtcggc
cgcggcgccgagtgtgtcagatttgacggcgctaccatcggtgccgccgagccggtccat
acccgcaagctgccggcgccgggcgagccctgggtcgcggcggtgagccgctcgcacggc
gatcccaaaagcgaagcgttcatcgacaacaggcccaatgccgtcagaaggacggtcggc
tcggccgtgaaattcggccggatcgcggaaggcagcgccgacatctatccccgcttcggg
cccacttcggagtgggatgtcggggccggctgcgcggtcgtgaccgcggccggcggcaag
gtcaccgacggcaagggcggcgagatcctgttcggccagcggcaggacaccggcttcatc
atcccggagttcatcgcctggggcgacccgcaggcggtagaccgctactga

DBGET integrated database retrieval system