KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2388Help
Entry
bll2388           CDS       T00109                                 

Gene name
cy2
Definition
(RefSeq) cytochrome c2
  KO
K08738  cytochrome c
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bll2388 (cy2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 RXLR Haem_bd
Motif
Other DBs
NCBI-GeneID: 1050583
NCBI-ProteinID: NP_769028
RhizoBase: bll2388
UniProt: Q89SL2
Position
complement(2602515..2602901)
Genome map
AA seq 128 aa AA seqDB search
MTGRLIFVLMLALATSSLATSSASAAEGDPARGKAVFQRTCENCHAAVIGVNKVGPSLWN
VIDRKPAIVPDFAYSDAMKANKQAWTPTTLDAYLADPRGDVHGVKMFFKGLPNPADRANV
IAYLQTLR
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtcgtctgatcttcgtgctcatgctggccttggccacatcgtctttggccacg
tcgtccgcctccgccgcggagggcgatccggcgaggggcaaggccgtcttccagcggacc
tgtgagaactgccacgcggcggtgatcggggtgaacaaggtcggcccaagtctctggaat
gtcatcgaccgcaagcccgcaatcgtcccggacttcgcctattctgatgcaatgaaggcc
aacaagcaggcctggacgccaacaacgctggacgcctatctcgccgacccccgcggcgac
gtccacggcgtcaagatgttcttcaaggggctgccgaaccccgcagaccgggccaatgtc
atcgcctatcttcagacgttgagatga

DBGET integrated database retrieval system