KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2530Help
Entry
bll2530           CDS       T00109                                 

Definition
(RefSeq) transcriptional regulator
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR
Motif
Other DBs
NCBI-GeneID: 1050251
NCBI-ProteinID: NP_769170
RhizoBase: bll2530
UniProt: Q89S75
Position
complement(2765272..2765787)
Genome map
AA seq 171 aa AA seqDB search
MQPKSPSILECPVGRAVETVGEWWSILILRDAFQGATKFDEFSQNLGIAPNILSRRLAHL
TASGMFVRRRYSERPPRYEYVLTDKARDFFPVVAALLAWGNRHLAPKGESILLASRADRR
PFDPVVVDAADMQPITLDNAVIIAGPRASRGMRKRLASLKAMNPAIAPAGD
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccaaatccccctccatcctggaatgcccggtcggccgcgccgtggagacggtc
ggcgaatggtggagcatattgatcctgcgggatgcgttccagggcgcgacgaagttcgac
gagttctcgcaaaatctcgggatcgcgccgaacatcctgtcgcggcgtctcgcccatctc
accgcgtcaggcatgttcgtccgccgccgttacagcgagcggccaccgcgttacgaatat
gtgctgacggacaaggcgcgggatttcttccccgtggtcgccgcgctgctcgcctggggc
aacaggcatctcgcaccgaagggtgaatccattctgctggcgagccgggccgatcgccgt
ccgttcgacccggtcgtggtcgatgccgccgacatgcagccgatcacgctcgacaatgcg
gtcatcatcgctgggccgcgcgccagccgcgggatgcgcaaacggctcgcttcgctcaag
gccatgaacccggccattgcgccggctggagactga

DBGET integrated database retrieval system