KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2541Help
Entry
bll2541           CDS       T00109                                 

Gene name
nadB
Definition
(RefSeq) L-aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00250  Alanine, aspartate and glutamate metabolism
bja00760  Nicotinate and nicotinamide metabolism
bja01100  Metabolic pathways
Module
bja_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bll2541 (nadB)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    bll2541 (nadB)
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     bll2541 (nadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 Thi4 HI0933_like NAD_binding_8 Phenol_Hydrox
Motif
Other DBs
NCBI-GeneID: 1050241
NCBI-ProteinID: NP_769181
RhizoBase: bll2541
UniProt: Q89S64
Position
complement(2780085..2781695)
Genome map
AA seq 536 aa AA seqDB search
MTTNNIHNLTRSTDDVVIVGGGLAGLFCALKLAPRPVTLISAAPLGQGASSAWAQGGIAA
AVAEGDTPEAHAADTVAVGGGLVDEAVALGIAREAAPRIHDLLAYGVPFDRDLEGRLAVG
REAAHSARRIVHVRGDGAGAAIIAALGEAARRTPSIRLIEGFVAEALLTEDGAVSGLQLR
EAGNPAAPPVLLASRAVVLATGGLGHLYAVTTNPLEASGSGLAIAARAGAVIADPEFVQF
HPTAIMVGRDPAPLATEALRGEGATLINADGERFMLARHPLAELAPRDIVARGVFAEIAA
GRGAFLDARQALGARFADKFPTVHASCIAAGIDPATQAIPIAPAAHYHMGGIAVDGRGRS
SIDGLWAGGEVSSTGAHGANRLASNSLLEAVIYAARIADDIAGRAIPSAARLPDALVAPR
GGAPDAAVVKRLRATMSAHVGVIRHGDGLAEAVHSFAALERDATSIAVRNMATTALLVAA
AAWTRCESRGAHFRSDHPADLPAQAKRTMTTLAAAREVAENLTERPMPRIAQPMIA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaacaacatccacaacctcactcgcagcaccgacgatgtcgtcatcgtcggc
ggcggccttgccggactgttctgtgcgctgaagctcgcgccgcggccggtgacgctgatc
tcggcggcaccgctcggacagggcgcttcgtccgcatgggcgcaaggcggcatcgccgcg
gcggtggccgagggcgatactccggaagcacatgccgcagatacggttgccgtcggcggc
ggccttgtcgacgaagcggtcgcgctcgggatcgcccgcgaggccgcgccgcgcatccac
gacctgctcgcctatggcgtgccgttcgaccgcgatctcgaaggcaggctcgcggtgggg
cgggaagctgcgcattcggcgcgccgcatcgtgcatgtgcgcggcgacggtgcgggcgca
gcgatcatcgcggcgctgggcgaggccgcgcgccggacgccgtcgatccggctgatcgag
ggtttcgtcgccgaagcgctgttgacggaagacggcgccgtctccggccttcagctgcgc
gaggccggcaatcctgccgccccgccggtcctgctcgcctcacgcgcggtggtgctcgcg
accggcggcctcggccatctctatgccgtcaccaccaatccgcttgaagcaagcggatcg
ggccttgcgatcgccgcgcgcgccggcgccgtgatcgccgatcctgaattcgtgcagttt
caccccaccgccatcatggtcggccgcgatccggcaccgctggcgacggaggcgctgcgc
ggcgaaggggcgacgctgatcaacgccgatggcgagcgtttcatgctggcgcgtcatccg
ctcgccgagctcgcgccgcgcgacatcgtggcccgcggcgtgttcgccgagatcgcggcc
gggcgcggcgcattcctcgacgcacggcaggcgctgggcgcacgcttcgccgacaaattc
ccgaccgtgcatgcgagctgcatcgccgccggcatcgatcccgccacgcaggccatcccg
atcgcgcccgccgcgcactaccacatgggcggcatcgcggtggacgggcgcggccgcagc
tcgatcgacgggctatgggccggcggcgaagtgtcctccaccggtgcgcatggcgccaac
cgcctcgcctcgaattcgctgctggaggccgtgatctacgccgcacgcatcgccgacgac
atcgccggccgcgccatcccctcggctgcccgccttcccgacgcattggtggcgccgcgc
ggcggcgcaccggatgccgcggtcgtgaagcggctgcgcgcgacgatgagcgcgcatgtc
ggcgtgatccgtcacggtgacggtcttgcggaggccgtgcacagcttcgctgcgctcgaa
cgtgacgcaacgagcatcgctgtccgcaacatggcgacaacagccctgctcgtcgccgct
gcggcctggacgcggtgcgagagccgcggcgcgcatttccgctccgatcatccggctgat
ctccccgcgcaggcgaagagaacgatgaccaccctcgcagcagcgcgcgaggtcgcagaa
aacctcaccgaacgcccaatgccgcgcatcgcgcaacccatgatcgcctga

DBGET integrated database retrieval system