KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2549Help
Entry
bll2549           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2339
Motif
Other DBs
NCBI-GeneID: 1050218
NCBI-ProteinID: NP_769189
RhizoBase: bll2549
UniProt: Q89S56
Position
complement(2792838..2795543)
Genome map
AA seq 901 aa AA seqDB search
MFDGPFDVFALIIAIIAFLIAIKASNQAAELRRRLSSLEEMVYTQRRVQPPPLMPAPVQA
EAPATTPAEPPPLAPEAEAPPPLVTEVAAPPPLEAGTGADAPPPLPALDIREPGFEERLG
TRWVVWIGGLALALGGFFMVRYSIEAGLVGPGVRVFLGGLFAAALLGAGEWSRRKESISN
IAALPIANIPAILTAAGTAVAFATIYAAYALYGFLVPATAFVLLGLVALGTLAAALLHGP
ALAGLGVVGAFVTPLLVSSGKPDYWALYIYLAIVTAASFGLARIRLWRWLAVTTIAFAVL
WIFPGLDTSDVQVAPHAFHAIAGFVLAALLVVCGFMFGPSIEDGEIEPVSSSSLGAYLFG
AMLIVLSSAHADLALIAFTLLVGATLFVAWRAPAATGALGAAAATVFIVFAEWAVRANPD
MLVLPGGPLPGIGPVATDSSVTLHLVTAAIFAAGFGMAGFFAQGRSNSAIIPVVWSAAGV
ATPIAILVALYARIAHLDRSIPFAILAVLLAAAFAAATEALARREDRPGAATSVALFATG
TLGALALALTFALEKGWLTIALALMSLGTAWISLQRPIPVLRRLAAIFAAIVTARIVYDP
RIVGDAVGTTPIFNWLLWGYGLPAVSFWGASIFLRRRGDDAPLRMVEAAAILFTALLAFM
EIRHFATGGQMTSAPSLLECALQVCVAFAMAIGLERLRLRSRSIVHNVGAVVLTAIGGLI
SVFGLLILENPLLWHIDVGGAVFNLLLLGYALPAVLMLLLSYAVVGERGKAYANTIAGGA
LVFALAYVTLEIRRFYHGPILSSGETTGAEQYTYSIGWLAFGVVLLGVGILVNSERARLA
SAAVIALTILKAFVIDMSTLTGVYRALSFMCLGVVLVAIGWLYQRILFRRQAPPPAPQTG
S
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacggcccgtttgacgtctttgcgctgatcattgcgatcatcgccttcctgatc
gcgatcaaggcctccaaccaggcggccgagctgcgccgccggctgagctcgctcgaagag
atggtttacacgcaacggcgagtgcagccgccgccgctgatgcccgcaccggtgcaggct
gaagcgcccgcgacaactccggccgagccaccgccgctcgcgcccgaggccgaggcgccg
ccgccgctcgtcaccgaagtggctgcgccgccaccgctcgaagcgggcaccggagccgat
gcaccgcctccgctgccggcgcttgatattagagagcctggcttcgaggagcgtctcggc
acgcgctgggtggtgtggatcggcggccttgcgctcgcgctcggcggcttcttcatggtg
cgctattcgatcgaggccggcctcgtcggccccggcgtgcgcgtgttcctcggcggcctg
ttcgcagccgcgctgctcggcgccggcgaatggtcgcggcgcaaggagagcatctccaac
atcgcggcgctgccgatcgccaatattcccgcgatcctcaccgcggccggcacggccgtc
gcgttcgcgaccatctatgccgcctacgcgctctatggcttcctcgtgcctgcgaccgcc
ttcgtgctgctcggcctcgtcgcactcggcacgcttgccgccgccctgctgcacgggccc
gcgctcgccggcctcggcgtggtcggcgcgttcgtgaccccgctcctcgtctccagcggc
aagccggactattgggcgctctacatctatcttgcgatcgtcaccgccgcgagcttcggc
cttgcccgcatccggctgtggcgctggcttgcggtgaccacgatcgccttcgctgtgctc
tggatcttcccgggtctggacaccagtgacgtgcaggtcgcgccgcacgccttccatgcg
atcgcgggattcgtgctggctgcgctgctcgtcgtctgcggcttcatgttcgggcccagc
atcgaggacggcgagatcgagccggtgtcgtcgagctcgctcggcgcctatctgttcggc
gcgatgctgatcgtgctgtcgagcgcgcatgcggatctggcgctgatcgccttcacgctt
ctcgtcggtgcgacgctgttcgtcgcctggcgcgcgccggcagcgaccggcgcgctgggc
gcggccgcggcgaccgtcttcatcgtgttcgccgagtgggcggtgcgcgccaatcccgac
atgctggtgctgcccggcggccccttgcccggcatcggaccggtcgcgaccgacagctcc
gtgacgctgcatctggtgacggccgcgatcttcgccgccggcttcggcatggccggcttt
ttcgcgcagggccgctcgaactcggcgatcattccggtggtgtggtcggcggcgggtgtc
gccacgcccattgcgatcctcgttgcgctctatgcacgcattgcccatctggatcgctcg
atcccgttcgcgatcctcgcggtgctgcttgccgcggcctttgccgccgccaccgaagcg
cttgcgcgccgcgaagatcggccgggcgctgcgacctccgtcgcgctgttcgcgaccggc
acgctcggcgcgctggcgctggcgctgaccttcgcgctcgagaagggctggctcacgatt
gcactggcgctgatgtcgctcggcaccgcctggatctcgctgcagcgcccgatcccggtc
ctgcgccggctcgcggccattttcgccgcgatcgtcaccgcgcgcatcgtctatgatccg
cgcatcgtcggcgatgccgtcggcacgacgccgatcttcaattggctgctgtggggctac
ggcctgccggcagtctcgttctggggcgcgagcatcttcctgcgccgccgcggcgacgat
gcgccgctgcgcatggtggaagccgccgcgatcctgttcaccgcgctgctcgccttcatg
gagatccggcactttgcgactggaggccagatgacgtctgcgccgtcgctgctcgaatgc
gcgctgcaagtctgcgtcgcgttcgccatggcgatcgggctggaacggctgaggctgcgc
agccgcagtatcgtgcacaatgtcggcgcggtggtgctcacggccatcggcgggctcatc
agcgtgttcggcctactgatcctggagaacccgctgctgtggcatatcgacgtcggcggc
gccgtgttcaacctgctgctgctcggctacgcgctgccggcggtgctgatgctgctgctg
tcctatgcggtggtcggcgagcgtggcaaggcctatgccaacaccatcgctggcggcgcg
ctcgtgttcgcgctcgcctatgtcacgctggagatccgccgcttctatcacggcccgatc
ctgtccagcggcgagacgacgggggccgagcaatacacctactcgatcggctggctcgcc
ttcggcgtggtgctgctcggcgtcggcatcctcgtcaactcggagcgcgcgcggcttgcg
tccgccgccgtcatcgcgctgacgatcctgaaggccttcgtgatcgacatgtcgacgctg
acaggcgtttaccgcgcgctgtcgttcatgtgcctcggcgtcgtgctggtcgcgatcgga
tggctctaccagcgcatcctgttccggcggcaggctccgccgccggctccacagacggga
agttga

DBGET integrated database retrieval system