KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2561Help
Entry
bll2561           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2385
Motif
Other DBs
NCBI-GeneID: 1050189
NCBI-ProteinID: NP_769201
RhizoBase: bll2561
UniProt: Q89S44
Position
complement(2804224..2804601)
Genome map
AA seq 125 aa AA seqDB search
MSTRFLAIFALILACASVPTRAQDVAAPFDADLQRLAEILGGLHYLRGICGSNEGNKWRS
EMQALIDAETPSGERRTRMIAGFNRGYNGFQQTYRSCTPAATVAIRRYIEEGSKISRDLT
ARYAN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcgatttctggccatttttgccctgatcctcgcctgcgcctcggtgcccacg
agggcccaggacgtggcggcgccgtttgacgccgatttgcagcggctggcggagatcctc
ggcggcctgcactatctgcgcggcatttgcgggtccaacgagggcaacaaatggcgcagc
gagatgcaggcgctgatcgatgccgaaaccccctccggagagcgccgcacccgcatgatc
gccggcttcaaccgcggctataacggcttccagcagacctaccggagctgcacgccggcc
gccaccgtcgcgatccgccgctacatcgaggaaggctcgaagatctcgcgcgatctcacg
gcgcgctacgcgaactga

DBGET integrated database retrieval system