KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2562Help
Entry
bll2562           CDS       T00109                                 

Gene name
nudD
Definition
(RefSeq) GDP-mannose mannosyl hydrolase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4 DUF4916
Motif
Other DBs
NCBI-GeneID: 1050206
NCBI-ProteinID: NP_769202
RhizoBase: bll2562
UniProt: Q89S43
Position
complement(2804803..2805237)
Genome map
AA seq 144 aa AA seqDB search
MSAVVQPTHPQIAVSAAIFRDGKVLLTRRARSPAKGFYSLPGGRVEFGESLHQALVREVD
EETGLAIEIIGLAGWREVLPATAGAGHYLIMSFAARWAAREPVLNDELDDYRWIAPDALA
SLGDIKLTGGLEEVIQSAARLIEA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgcggtcgtccagcccacccatccccagattgcggtcagcgccgcgatttttcgt
gatggcaaggtgcttctgacccgccgcgcccgatcgcccgccaaggggttctattcgctg
cccggcggccgggtcgagttcggcgaatcgctgcaccaggccctggtgcgcgaggtggac
gaggagaccgggctcgccatcgagatcattggccttgccggctggcgcgaggtgctgccg
gccacggccggcgccggccactacctgatcatgtcctttgccgcccgctgggcggcccgg
gagccggttttgaacgacgagctcgacgactaccgctggatcgcccccgatgccctggcg
agcctcggcgacatcaagctgaccggggggctggaggaggtcattcaatccgccgcgcgc
ttgattgaggcatag

DBGET integrated database retrieval system