KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2580Help
Entry
bll2580           CDS       T00109                                 

Gene name
cbbR
Definition
(RefSeq) transcriptional regulator
  KO
K21703  LysR family transcriptional regulator, low CO2-responsive transcriptional regulator
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Transcription factors [BR:bja03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    bll2580 (cbbR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 PBP_like MarR_2 HTH_5 HTH_20 Coq4 PBP_like_2
Motif
Other DBs
NCBI-GeneID: 1050152
NCBI-ProteinID: NP_769220
RhizoBase: bll2580
UniProt: H7C6J6
Position
complement(2822117..2823094)
Genome map
AA seq 325 aa AA seqDB search
MSAKEFSYNGPSHAAAQLRHLTIRQLRSLAALSAKGSVTAASGHLGLTQPAVTQQLRQLQ
DLAGLPLVQRTGDGMLLTEAGKEVLALAERVEAAIMDCQGALDLLAGRTGGTVHLGAVST
AKYFVPHAIAAFTKRYPKIEIRLTIGNREEIREAMHGYDLDFAVMGRPPADVSVDVRQLG
RNPHIIVARKGHWLEKDSGLSLTDLVHETFLTREPGSGTRTLMEGMFQKSDLEPVIGMEM
SSNETIKQAVIAGLGIAFISAHTVAHELAEGRLIVLDVAGLPIVRQWYVIRRSDKVLLPP
AQAMFDFLGSEGSNYLPDVPEFGER
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaaagaattttcttataatggccccagccatgcggcggcccagctccggcat
ctgacgatccggcagcttcgctcgctcgcggcgctttcggccaagggcagcgtgacggcg
gcctccggccatctcggcctgacgcagccggctgtgacccagcagttgcgccagcttcag
gacctcgccggcctgcctttggtgcagcggaccggcgacggcatgctgctgacggaagcc
ggcaaggaggttctggcgctcgccgagcgcgtcgaggccgcgatcatggactgccagggc
gcgctcgacctgctcgcggggcgaaccggcggcaccgtgcatctcggcgcggtctcgacc
gcgaagtatttcgtcccgcatgcgatcgcggctttcaccaagcggtacccgaagatcgag
atcaggctcaccatcggcaatcgcgaggagatccgcgaggccatgcacggctacgacctc
gatttcgcggtgatgggtcggccaccggccgacgtcagcgtcgacgtccgtcagctcgga
cgcaatccgcacatcatcgtcgcgcgcaaggggcactggctggagaaggattccggcctc
agcctgaccgacctcgtgcacgagaccttcctcacccgcgagccgggttcgggcacgcgc
acgctgatggagggcatgttccagaagtcggacctcgagccggtcatcggcatggagatg
agcagcaacgagaccatcaagcaggcggtgatcgccgggctcggcatcgccttcatctcg
gcccacaccgtggcgcacgagcttgccgagggccgcctgatcgtgcttgacgtcgccggc
ctgccgatcgtgcggcaatggtacgtgatccgccgcagcgacaaggtgctgctgccgccg
gcgcaggcgatgttcgattttctgggctcggaagggtcgaactatctgcccgacgtgccc
gagttcggcgagcgctag

DBGET integrated database retrieval system