KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2618Help
Entry
bll2618           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1499 DUF998
Motif
Other DBs
NCBI-GeneID: 1049057
NCBI-ProteinID: NP_769258
RhizoBase: bll2618
UniProt: Q89RZ4
Position
complement(2866236..2867090)
Genome map
AA seq 284 aa AA seqDB search
MARRFSAPYQSEPVSSLASWARNLAVFAVVAVAVSILVVRFGFLEPKPALATFFGGLAIA
ALSILFGLAGFAAIWQNGSRGMARILLAFLIDGMILAYPAYLGLQYRKLPAIHDVTTDPI
DPPRFDALARLRTGEGANTAVYAGLYSAEQQRHFYPDIEPIELEIPVDRAYAIALQIVNK
RKWLVIDERAPQPPRRIGRIEAVARTPIMGLREDISIRVVPDGDDSRVDIRSASRYFESD
LGSNAARVTKFIDDLNTAADADALKPVKKTPVTPPKAPAKTVKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaggttttccgctccctaccagtcggagcccgtgtccagcctcgccagctgg
gcgcgcaatctggccgtgttcgcggtggtggcggtggcggtgtcgatcctcgtcgtccgg
ttcggcttcctggagccgaagccggcgctcgccaccttcttcggcggcctcgccatcgcc
gcgctctcgatcctgttcggcctcgccggcttcgccgcgatctggcagaacggctcgcgc
ggcatggcgcgcatcctgctcgccttcctgatcgacggcatgatcctcgcctacccggcc
tatctcggcctgcaataccgcaagctgccggcgatccacgacgtcacgaccgacccgatc
gacccgccccgcttcgacgcgctggcgcgcctgcgcaccggtgaaggcgccaataccgcg
gtttatgccggcctctattcggccgagcagcagcgccatttctatcccgatatcgagccg
atcgagctcgagatcccggtcgaccgcgcctatgcgatcgcactccagatcgtcaacaag
cgcaaatggctcgtcatcgacgagcgcgcgccgcagccgccgcgccgcatcggacgcatc
gaggcggtggcgcgcacgccgatcatgggtttgcgcgaggacatttccatcagggtcgtg
cccgacggcgacgattcccgcgtcgatatccgctccgcctcgcggtatttcgagagcgac
ctcggcagcaacgccgcccgcgtcacaaaattcatcgacgatctcaacaccgccgccgat
gcggacgcgctgaagccggtgaagaagaccccggtgacgccgccgaaggcaccggcgaag
acggtgaagaagtga

DBGET integrated database retrieval system