KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2850Help
Entry
bll2850           CDS       T00109                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bll2850
   01230 Biosynthesis of amino acids
    bll2850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bll2850
   00030 Pentose phosphate pathway
    bll2850
   00051 Fructose and mannose metabolism
    bll2850
   00052 Galactose metabolism
    bll2850
  Energy metabolism
   00680 Methane metabolism
    bll2850
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     bll2850
Protein phosphatases and associated proteins [BR:bja01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     bll2850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3134173..3135381)
Genome map
AA seq 402 aa AA seqDB search
MPIREVDMARKRIGILTGGGDVAGLNAVIKSVTYRGSEDDIEVVGLRRGWEALTHLNLDD
PNSRSHYVIPLNRENTRTIDRRGGTVLHSSRVNPSKIQKLPGHLVGNEVPVSLSTNGGIA
TKTWDLTSRVLANLSGLGIEHLIAIGGDDTLSYAAKLNELGVKIIAIPKTMDNDVRNTEY
CIGFSTAITRASDAIQRQRTTVGSHERIGIFRVFGRDAGFTALYTAYATSIRCLIPEHKV
DLDKLIQLLIEDKRANPSNYALIVLSEGAQWEGYKLREYGEPDAYGHRKKANVAESLADE
IKQRTGEETITSDLTYDLRSGDPDFIDKLVALTFGNMAYDAMLESKTGLMSALVEGRYDL
VPIPDAKLGPRKLDVASSYNTERYRPIYANKQGLPIFLNRAS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccgggaggtggatatggcaagaaaacgcatcggcattctcacgggcggtggc
gacgtcgccggcctcaatgcagtcatcaagagcgtgacttatcgcggcagtgaggacgac
atcgaggttgtcggtctgcgccgtggttgggaggccctcacgcacctgaacctcgacgac
ccaaacagcaggtcccactacgtcatcccgctgaaccgtgaaaacacgcgaaccatcgac
cggcgcggcggcaccgtgctgcactcgagccgcgtcaatccctccaaaatacaaaagctg
cccggtcatctcgtcggcaatgaggttccggtctcgctgagcaccaacggcggcatcgcg
acaaagacatgggacctcaccagccgggtgctcgctaacctttcgggacttggcatcgaa
cacctgatcgccatcggtggcgacgacacgctcagttatgcggccaagctcaacgaactc
ggcgtcaagatcatcgccatcccgaagacgatggataatgacgtccgcaacaccgagtac
tgcatcggcttctcgaccgcgatcacccgcgccagcgatgccatccagcggcagcgcacc
accgtcggctcgcatgagcgaattggcattttccgcgtctttggtcgcgatgccggattt
acggcactctacaccgcgtatgcgacctcgatacgatgcctcataccggagcataaggtc
gacctcgacaagctgatccagttgctcatcgaggacaagcgcgccaatccaagcaactac
gcgctgatcgtgctcagcgagggagctcagtgggaaggctacaagctgcgggaatacggc
gagcctgacgcctacggtcaccgcaagaaggccaacgtggcggaatcgcttgccgacgag
atcaagcagcgcaccggcgaggagacgatcacctccgatctcacctacgatctgcgatcg
ggcgatccggacttcatcgacaagcttgtggccctgactttcggtaacatggcctacgat
gccatgctggaaagcaagaccggcctcatgtcggcgctggtcgagggccgctacgacctc
gtgcccatccctgacgccaagctcggtccgcgcaaattggacgttgcgagcagctacaac
acggagcgctaccgccccatctacgccaacaagcaggggctgccgatctttctcaaccgc
gcgtcttag

DBGET integrated database retrieval system