KEGG   Bradyrhizobium japonicum USDA110: bll2851Help
Entry
bll2851           CDS       T00109                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bja01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bja01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bja00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bja00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bja00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:bja00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3135450..3136595)
Genome map
AA seq 381 aa AA seqDB search
MRLTLSVIKADVGSVGGHTKPSSRMMATVEGEVAKAICNGLLIDGFICHTGDDIAIIMTH
TRGEGSSEVHQLAWKTFLAATSVAKTSGLYGAGQDLLADAPSGNIRGAGPGVAELSFDHS
LSGARPAESFMVFAADKCGPGAYNLPLYLAFADPMYCAGLMLPPMIKGFRFHVIDMDNTA
GDSLLELDAPDDSYHIAALLRDNERFGIDRIISRTHGEVVVAVSAQRLHAIAGKYTGKDD
PVAIVRNQGIFPAPEEIISPFAKAHFVGGDARGSHVMPLMPVPLNTPVTGMYCLPIVSCV
GFSIDREGRFAESYTDFFDNPAWDEVRRRAQRKAIEMRSQGWSGAAMLPYSELEYGGFRD
TVSGLLKRFRLRDDRKPEAAE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagactcactctttcagtcatcaaagctgacgttggctccgttggcgggcatacgaaa
ccgtcttcacgcatgatggcgactgtcgagggcgaggttgccaaggcgatctgcaatggt
ctgctgatcgacggtttcatctgccacaccggcgacgacattgcgatcatcatgacgcac
acacggggcgaaggaagctccgaggtccatcaactcgcctggaagacgttcctcgcggcc
acctcggtcgcgaaaacctccgggctctatggcgctggccaggatcttctcgccgacgcg
ccttccgggaacattcgcggcgccggcccaggcgtcgccgagctcagcttcgaccacagc
ctctccggcgcgcgacccgcggagtcctttatggtgttcgcggccgacaaatgcggcccc
ggcgcctacaacctgccgctctatctcgcctttgccgaccccatgtactgcgcggggctg
atgctgcctccgatgatcaagggattccgtttccatgtcatcgacatggacaacacagcc
ggcgacagcctcctcgagctcgacgcacccgacgacagctaccacattgccgccctgctt
cgcgacaacgagcgcttcggcatcgatcgcatcatttctcgaacccatggcgaggtcgtc
gtggccgtttcggcacagcgcctccacgcaatcgcaggcaagtacaccggcaaggatgat
ccagtcgcgatcgtcaggaaccaggggatcttcccagctccggaggaaataatctcgccg
ttcgccaaagcgcacttcgtgggcggcgatgcacgcggctcgcatgtgatgccgctcatg
ccggtgccactcaacacgcccgttaccggcatgtactgcctgccgatcgtttcttgcgtc
ggcttttcgatcgacagggaaggccgctttgccgaatcctacaccgatttcttcgacaac
ccggcatgggatgaggtccgccggcgtgcccagcgcaaggccatcgagatgcgcagccaa
ggctggtccggcgccgccatgctaccctattccgaactggaatatggcggcttccgcgac
accgtgtccggactgctgaagcgttttcgactgcgcgacgaccgcaagccggaagcggcc
gagtag

DBGET integrated database retrieval system