KEGG   Bradyrhizobium diazoefficiens USDA 110: bll2851Help
Entry
bll2851           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bll2851
   01230 Biosynthesis of amino acids
    bll2851
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bll2851
   00030 Pentose phosphate pathway
    bll2851
   00051 Fructose and mannose metabolism
    bll2851
  Energy metabolism
   00680 Methane metabolism
    bll2851
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     bll2851
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     bll2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3135450..3136595)
Genome map
AA seq 381 aa AA seqDB search
MRLTLSVIKADVGSVGGHTKPSSRMMATVEGEVAKAICNGLLIDGFICHTGDDIAIIMTH
TRGEGSSEVHQLAWKTFLAATSVAKTSGLYGAGQDLLADAPSGNIRGAGPGVAELSFDHS
LSGARPAESFMVFAADKCGPGAYNLPLYLAFADPMYCAGLMLPPMIKGFRFHVIDMDNTA
GDSLLELDAPDDSYHIAALLRDNERFGIDRIISRTHGEVVVAVSAQRLHAIAGKYTGKDD
PVAIVRNQGIFPAPEEIISPFAKAHFVGGDARGSHVMPLMPVPLNTPVTGMYCLPIVSCV
GFSIDREGRFAESYTDFFDNPAWDEVRRRAQRKAIEMRSQGWSGAAMLPYSELEYGGFRD
TVSGLLKRFRLRDDRKPEAAE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagactcactctttcagtcatcaaagctgacgttggctccgttggcgggcatacgaaa
ccgtcttcacgcatgatggcgactgtcgagggcgaggttgccaaggcgatctgcaatggt
ctgctgatcgacggtttcatctgccacaccggcgacgacattgcgatcatcatgacgcac
acacggggcgaaggaagctccgaggtccatcaactcgcctggaagacgttcctcgcggcc
acctcggtcgcgaaaacctccgggctctatggcgctggccaggatcttctcgccgacgcg
ccttccgggaacattcgcggcgccggcccaggcgtcgccgagctcagcttcgaccacagc
ctctccggcgcgcgacccgcggagtcctttatggtgttcgcggccgacaaatgcggcccc
ggcgcctacaacctgccgctctatctcgcctttgccgaccccatgtactgcgcggggctg
atgctgcctccgatgatcaagggattccgtttccatgtcatcgacatggacaacacagcc
ggcgacagcctcctcgagctcgacgcacccgacgacagctaccacattgccgccctgctt
cgcgacaacgagcgcttcggcatcgatcgcatcatttctcgaacccatggcgaggtcgtc
gtggccgtttcggcacagcgcctccacgcaatcgcaggcaagtacaccggcaaggatgat
ccagtcgcgatcgtcaggaaccaggggatcttcccagctccggaggaaataatctcgccg
ttcgccaaagcgcacttcgtgggcggcgatgcacgcggctcgcatgtgatgccgctcatg
ccggtgccactcaacacgcccgttaccggcatgtactgcctgccgatcgtttcttgcgtc
ggcttttcgatcgacagggaaggccgctttgccgaatcctacaccgatttcttcgacaac
ccggcatgggatgaggtccgccggcgtgcccagcgcaaggccatcgagatgcgcagccaa
ggctggtccggcgccgccatgctaccctattccgaactggaatatggcggcttccgcgac
accgtgtccggactgctgaagcgttttcgactgcgcgacgaccgcaagccggaagcggcc
gagtag

DBGET integrated database retrieval system