KEGG   Bradyrhizobium japonicum USDA110: bll3057Help
Entry
bll3057           CDS       T00109                                 

Gene name
folK
Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bja00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3376063..3376554)
Genome map
AA seq 163 aa AA seqDB search
MASVLIALGGNVGDVRATFGKAIAHICGMAQAALTARSSDYATPPWGDEEQDPFINACIE
IETGLDPHALLFVLQKVEQKFGRTRTKERPWGPRTLDLDMIAYDDVRLQKPDLTLPHPRL
FERAFVLVPLAEIAPDRVISGIRVRDGLSSISTQGIERLPDTG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgtgctgatcgcactgggcggcaatgtcggcgatgtccgcgcgacgttcggc
aaggcgatcgcgcacatctgcggcatggcgcaggccgcgctgaccgcgcgctcctcggac
tatgcaacgccgccctggggcgatgaggagcaggatcccttcatcaatgcctgcatcgag
atcgaaaccggcctcgatccgcacgcgctgctgttcgtgctgcagaaggtcgagcagaaa
ttcggccgcacgcggaccaaggagcggccctgggggccgcgcacgctcgatctcgacatg
atcgcctatgacgatgtcaggctgcagaagcccgacctgaccttgccgcatccgcgtctg
ttcgagcgcgccttcgtgctggtgccgctggccgagattgcgcccgaccgcgtgatctca
ggcattcgcgtgcgcgacgggctttccagcatctcgacgcaaggcattgagcggcttccg
gataccggttaa

DBGET integrated database retrieval system