KEGG   Bradyrhizobium diazoefficiens USDA 110: bll3057Help
Entry
bll3057           CDS       T00109                                 

Gene name
folK
Definition
6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    bll3057 (folK)
Enzymes [BR:bja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     bll3057 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3376063..3376554)
Genome map
AA seq 163 aa AA seqDB search
MASVLIALGGNVGDVRATFGKAIAHICGMAQAALTARSSDYATPPWGDEEQDPFINACIE
IETGLDPHALLFVLQKVEQKFGRTRTKERPWGPRTLDLDMIAYDDVRLQKPDLTLPHPRL
FERAFVLVPLAEIAPDRVISGIRVRDGLSSISTQGIERLPDTG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgtgctgatcgcactgggcggcaatgtcggcgatgtccgcgcgacgttcggc
aaggcgatcgcgcacatctgcggcatggcgcaggccgcgctgaccgcgcgctcctcggac
tatgcaacgccgccctggggcgatgaggagcaggatcccttcatcaatgcctgcatcgag
atcgaaaccggcctcgatccgcacgcgctgctgttcgtgctgcagaaggtcgagcagaaa
ttcggccgcacgcggaccaaggagcggccctgggggccgcgcacgctcgatctcgacatg
atcgcctatgacgatgtcaggctgcagaagcccgacctgaccttgccgcatccgcgtctg
ttcgagcgcgccttcgtgctggtgccgctggccgagattgcgcccgaccgcgtgatctca
ggcattcgcgtgcgcgacgggctttccagcatctcgacgcaaggcattgagcggcttccg
gataccggttaa

DBGET integrated database retrieval system