KEGG   Bradyrhizobium diazoefficiens USDA 110: bll3059Help
Entry
bll3059           CDS       T00109                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    bll3059
Enzymes [BR:bja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     bll3059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3376921..3377898)
Genome map
AA seq 325 aa AA seqDB search
MTERGQEHRSLTGPGTDRRDRIAPNPVLTPPPRPRTSTRMNALPSPSVPPAGSAGRDVLR
TLLERPLPAVMGVLNVTPDSFSDGGDFIAPDLALERARAMIADGVDIIDIGAESTRPYKG
AKAVTAEDELARLRPVLSGVVALGVPVSIDSMKAEVVAFALDQGAAIANDVWGLQRDAGM
APLVAARGVPVIVMHNRESVDSAIDIIADMKAFFLRSLDIAAKAGIARDKIVLDPGIGFG
KTAEQSMTALARLREFDMFGLPILVGASRKRFIASVSPSEPKERLAGSIAAHLIAAQRGA
RIIRTHDVAETLQALRVANAIESKQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcgtgggcaagagcatcgttccctcactggccccggaacggatcggcgcgac
cggatcgcccccaatcccgtcttgactccccctccccgaccgcgcacatccacgcgcatg
aatgccttgccatccccttccgtcccgccggccggctcggccgggcgtgacgtgctgcgg
acactgctggaacggccactcccggcggtgatgggcgtgctcaacgtcaccccggattcc
ttctccgacggcggcgatttcatcgcgcccgacctggcgctcgaacgggcccgggcgatg
atcgccgatggcgtcgacatcatcgacatcggcgcggagtccacccggccctacaagggc
gccaaggccgtcacggccgaggacgagcttgcccggctgaggccggtgctatcgggcgtg
gttgcgctcggcgtgccggtctcgatcgacagcatgaaggcggaggtggtggccttcgcg
ctcgaccagggcgcggcgatcgccaacgacgtctggggcctgcaacgcgatgccggcatg
gcgccgctggtagccgccagaggcgtccccgtcatcgtcatgcacaaccgcgagagcgtg
gattccgccatcgacatcatcgcggacatgaaggcgttcttcctgcgctcgctggatatc
gccgccaaggccggcatcgcacgcgacaagatcgtgctcgatcccggcatcggcttcggc
aagaccgccgagcagagcatgaccgcgctggcgcggctgcgcgaattcgacatgttcggc
ctgccgatcctggtcggcgcctcgcgcaagcgcttcatcgcctcggtgtcgccgtcggaa
ccgaaagagcggctcgccggctcgatcgcggcgcatctcatcgccgcgcagcgcggcgcc
aggatcatccggacccatgacgtcgccgagaccttgcaggccctgcgggtcgcgaacgca
atcgagagcaagcaatga

DBGET integrated database retrieval system