KEGG   Bradyrhizobium diazoefficiens USDA 110: bll4347Help
Entry
bll4347           CDS       T00109                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4803313..4804380)
Genome map
AA seq 355 aa AA seqDB search
MVKVLDEHERTMAFAEVALGQIRSLRQTAIPRNYEIWYVYATGYNAPLNKIINETLARHG
KLTEADLEQIYETYLSHIKTTDRIDKVGARVIGEIDDVMKVLGDALGMTGSYDASLSGAT
ERLSSAKSREQIKAIVETLVRSTSEMRETNKALEDRLTLSRNEISNLQQSLEAIRAESLT
DPLTGLGNRKYFDRMIGMAVQSALASGEPLSLLLFDIDHFKSFNDSYGHLTGDQVLRLVG
LSMKQTIKGQDITARYGGEEFAVLLPNTALRQALTVADHIRRAVMAKELKKKSTGEILGR
VTISVGVSMLKPGDDTDALIERADACLYAAKRNGRNRVICEADPEFAVETHSRVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaggtgcttgacgaacacgaacgcacgatggcgttcgccgaggtggcgctcggt
cagatccgatcgcttcggcagacggcaattccccgcaattacgagatctggtacgtctac
gcgaccggctacaacgcaccgctcaacaagatcatcaacgagacgctggcccgccacggc
aagctgaccgaagccgatctcgagcagatctacgagacctatctctcccacatcaagacc
accgaccgcatcgacaaggtcggtgcgcgcgtcatcggcgagatcgatgacgtgatgaag
gttctcggcgatgcgctcggcatgaccggctcctacgacgccagcctgtcgggcgcgaca
gaacggctgtcgtcggccaagagccgcgagcagatcaaggcgatcgtcgagacgctggtg
cgctcgaccagcgagatgcgtgagaccaacaaggcgctggaagaccggctgacgctgtcc
aggaacgagatcagcaatctccagcagagcctggaggcgatccgtgccgagagcctgacc
gacccgctcacgggcctcggcaaccgcaaatatttcgatcgcatgatcggcatggccgtt
cagagtgcgctcgcatcgggcgagccgctgtcactgctgctgttcgacatcgaccacttc
aagtcgttcaacgattcctacggccatctcaccggcgaccaggtgctgcgcctggtcggc
ctgtccatgaagcagaccatcaagggccaggacatcaccgcgcgctacggcggcgaggag
ttcgccgtcctgctgcccaacacggcgctgcgccaggccctcacggtcgccgatcacatc
cgccgcgccgtgatggcgaaggagttgaagaagaagtccaccggcgagattctcggccgc
gtcaccatctccgtcggcgtctccatgctcaagccgggcgacgacaccgacgcgctgatc
gaacgcgccgatgcctgcctctacgccgccaagcgcaacggccgcaaccgcgtgatctgc
gaagcggatccggaatttgccgttgagacgcacagccgggtggcgtga

DBGET integrated database retrieval system