KEGG   Bradyrhizobium japonicum USDA110: bll4594Help
Entry
bll4594           CDS       T00109                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bja01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bja01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5086667..5087845)
Genome map
AA seq 392 aa AA seqDB search
MSINIDSGQDSDQEHDDVMYPQVLPFVLIHAGCLAAIWSGVSWQAVAICVALYWLRMFGI
TAGYHRYFSHRAYATSRAFQFILAFLAQSSAQKSVLWWAAKHRHHHLHSDTAQDVHSPRH
KGFVYSHLGWIFYRQHDATDLVKVSDLASYPELMWLHRLELLPAVVLAGLCFLIAGWSGL
VVGFMWSTVVLYHATFCINSLAHVHGRRRYVTGDDSRNNWLLALLTMGEGWHNNHHAYQA
SARQGFYWYEVDLTYYALVALSWLGIVWDLKLPPRQVLRNEHRLGSRVVKQAAEQLAARF
DPEHIALAIRTSIHETELSVRDALSLLQHRADLRLSSMPTREQLLAEAQRMFAKTISLDD
IVDRAYELLHDSVGFLLATPALSANTNAKSGI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgtctatcaatatcgattcaggccaggactccgatcaggaacacgacgacgtcatgtat
ccgcaggtcctgccgtttgtattgatccacgcgggatgcctcgcggcgatctggtcgggc
gtctcgtggcaagccgttgcaatctgcgttgccctgtattggctgcgcatgttcggcatc
actgccggatatcaccggtacttctcgcatcgggcttacgccacaagccgggcgttccag
ttcatccttgccttccttgcccagagcagcgcccagaaaagcgtgctttggtgggctgcc
aagcaccgccatcatcatcttcactcggatacggcgcaagatgtccattcaccccggcac
aagggcttcgtgtacagtcatctcggctggatcttttaccggcagcacgatgcgaccgac
ctcgtgaaggtatcggatctggcgtcgtatcccgagttgatgtggctgcaccggctggag
ctgttgccggcggtcgtgctcgcgggtctgtgcttcctgattgccgggtggtcggggctc
gtggtcggatttatgtggagcaccgtggttctgtatcacgcgacattctgcatcaactcc
ctcgcacatgttcacggacgcaggcggtatgtgaccggcgacgattcccgcaacaactgg
ctgctcgccctgctgacgatgggcgaggggtggcacaacaaccatcacgcctaccaggcc
agcgcccggcagggcttctactggtatgaggtcgatctaacctactatgccctggtcgcc
ttgtcctggctcgggatcgtctgggatctgaagttgccgcccaggcaggttctgcgcaat
gagcatcgtttgggatcgcgcgtggtcaagcaagcggccgagcagctcgccgctcgcttt
gatcccgagcacatcgcgctcgcgatcagaacgtcgatccacgagactgaattatcggtc
cgggacgcgctcagtctgctgcagcaccgtgccgacttgcgcctgtccagcatgccgacc
cgcgagcagttgctggctgaggcgcaacgcatgttcgccaagaccatatccctcgacgat
atcgtcgaccgcgcctacgaactcctgcacgattctgtcggttttctcctggccacgccc
gctctatcggccaacacgaacgcgaagagtggcatttag

DBGET integrated database retrieval system