KEGG   Bradyrhizobium diazoefficiens USDA 110: bll4754Help
Entry
bll4754           CDS       T00109                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    bll4754
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    bll4754
Enzymes [BR:bja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     bll4754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5263164..5264192)
Genome map
AA seq 342 aa AA seqDB search
MSTRAFITGVSGTELTAAEREFIRAERPWGFILFKRNIATPAQVAALVAELRAVANAPDA
PVLIDQEGGRVQRLGPPHWPVYPPGAVFANLYDSDSALGLTAARLSARLIAADLADLGIT
VDCLPLADVPVQGADAVIGNRAYGTEPGKVAAIARAVTEGLEQGGVLPVLKHIPGHGRAT
ADTHFQLPTVDTPRDELERTDFAAFKPLADLPMAMTAHVVFSAVDPAHPATTSATMIAQV
IRGAIGFQGLLMSDDVSMNALAGSIADRTRAIFAAGCDMALHCNGNIEEMREVAGQTPEL
SGKALERATAALAARKAPQPFDRAAARAELDALIARANTASA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgggccttcattaccggcgtatccggaacggaactgaccgccgccgagcgg
gagtttatccgtgccgagcgcccatggggcttcatcctcttcaagcgcaatatcgccacg
ccggctcaagttgctgcattggttgcagaattgcgcgcggttgcgaacgcacccgacgcc
cccgtcctgatcgatcaggagggtggacgggtgcagcggctgggtccgccgcactggccc
gtctatccgccgggcgccgtattcgcgaatctgtacgacagtgattcggcgctcgggctc
accgcggcacgcctcagcgcgcggctgatcgcggccgatctcgccgatctcggcattacc
gtggattgcttgccgctggctgacgtgccggttcagggcgcggatgccgtcatcgggaac
cgggcctatggcaccgaacctggcaaggtcgcggcgatcgcgcgcgcggtgaccgagggc
ctggagcagggtggcgtgctgccggtcctcaagcacattcccggccacggccgcgccacc
gccgatacccatttccagctgccgaccgtcgacacgcccagggacgagctggagcggacc
gacttcgcggcgttcaagccgctggcggacctgccgatggccatgactgcacatgttgtg
tttagcgcggtcgaccccgcccatccggcgacgacatctgcgacaatgattgctcaggtg
attcgcggcgcaatcgggttccagggtttgttaatgagtgatgacgtgtcgatgaacgcg
ctggcgggaagcattgccgatcggacccgcgccatcttcgcggccggctgcgacatggct
ctgcattgcaacggcaacatcgaggagatgcgcgaggtcgccggccagacgcctgaactg
tccggcaaggcgctggagcgggcgacagccgcgctcgcggcgcgcaaggcgccgcagcca
ttcgaccgggcggccgcacgcgccgaactggacgcattgatcgcacgggcaaacacggca
tccgcatga

DBGET integrated database retrieval system