KEGG   Bradyrhizobium diazoefficiens USDA 110: bll4807Help
Entry
bll4807           CDS       T00109                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00051  Fructose and mannose metabolism
bja00562  Inositol phosphate metabolism
bja00710  Carbon fixation in photosynthetic organisms
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
bja01230  Biosynthesis of amino acids
Module
bja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bja_M00002  Glycolysis, core module involving three-carbon compounds
bja_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bll4807 (tpiA)
   00051 Fructose and mannose metabolism
    bll4807 (tpiA)
   00562 Inositol phosphate metabolism
    bll4807 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bll4807 (tpiA)
Enzymes [BR:bja01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bll4807 (tpiA)
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bll4807 (tpiA)
  Exosomal proteins of bladder cancer cells
   bll4807 (tpiA)
  Exosomal proteins of melanoma cells
   bll4807 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1052213
NCBI-ProteinID: NP_771447
RhizoBase: bll4807
UniProt: Q89KU3
Position
complement(5326376..5327131)
Genome map
AA seq 251 aa AA seqDB search
MTDAIRPLIAGNWKMNGLKASAAEFDAMLNGAADVATKADLLVCPPATLIAAFADKARGK
KVAVGAQDCHPKASGAHTGDIAAEMLANAGATAIIVGHSERRADHGEGDALVRQKAEAAW
RAGVTAIVCIGETQAQRDAGQTLDILRGQLDGSLPDGSTAANLVVAYEPVWAIGTGLTPT
VQDVEQIHGFIREFLTSRFSVDGAKMRILYGGSVKPSNAAELMAVKNVNGALVGGASLKA
ADFLAIAKGCP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccatccgaccgctgatcgccggcaactggaaaatgaacggcctgaaggcc
tccgctgccgaattcgacgccatgctcaatggcgcggcagacgtggccaccaaggccgat
ctgctggtctgcccgccggcgaccctgatcgcggcctttgccgacaaggcgcgcggcaag
aaggtcgcggttggggcccaggattgccaccccaaggcctccggcgcccataccggcgat
atcgccgccgaaatgctcgcgaatgcgggcgcgaccgccatcatcgtcggccattccgag
cgccgcgccgaccatggcgagggcgatgctttggtgcggcagaaggcggaagccgcctgg
cgggccggggtgacggcgatcgtctgcatcggcgagacgcaagcccagcgcgatgccggc
cagaccctggacatcctgcgcggccagctcgacggctcgctgccggacggctctaccgcg
gccaacctggtcgtggcctatgagcccgtctgggcaatcggcaccggcctgacccccaca
gtccaggatgtcgagcagattcatgggtttatccgggagttcctgacctcccggtttagc
gtggacggggcgaagatgcggatcctctatggcggttcggtcaagccctcgaacgcggcc
gagctgatggccgtgaagaacgtcaacggagctctggtcggcggcgccagcctcaaggcg
gccgatttccttgcgatcgccaagggctgcccctag

DBGET integrated database retrieval system