KEGG   Bradyrhizobium japonicum USDA110: bll4807Help
Entry
bll4807           CDS       T00109                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    bll4807 (tpiA)
   01230 Biosynthesis of amino acids
    bll4807 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bll4807 (tpiA)
   00051 Fructose and mannose metabolism
    bll4807 (tpiA)
   00562 Inositol phosphate metabolism
    bll4807 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bll4807 (tpiA)
Enzymes [BR:bja01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     bll4807 (tpiA)
Exosome [BR:bja04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   bll4807 (tpiA)
  Exosomal proteins of bladder cancer cells
   bll4807 (tpiA)
  Exosomal proteins of melanoma cells
   bll4807 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5326376..5327131)
Genome map
AA seq 251 aa AA seqDB search
MTDAIRPLIAGNWKMNGLKASAAEFDAMLNGAADVATKADLLVCPPATLIAAFADKARGK
KVAVGAQDCHPKASGAHTGDIAAEMLANAGATAIIVGHSERRADHGEGDALVRQKAEAAW
RAGVTAIVCIGETQAQRDAGQTLDILRGQLDGSLPDGSTAANLVVAYEPVWAIGTGLTPT
VQDVEQIHGFIREFLTSRFSVDGAKMRILYGGSVKPSNAAELMAVKNVNGALVGGASLKA
ADFLAIAKGCP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccatccgaccgctgatcgccggcaactggaaaatgaacggcctgaaggcc
tccgctgccgaattcgacgccatgctcaatggcgcggcagacgtggccaccaaggccgat
ctgctggtctgcccgccggcgaccctgatcgcggcctttgccgacaaggcgcgcggcaag
aaggtcgcggttggggcccaggattgccaccccaaggcctccggcgcccataccggcgat
atcgccgccgaaatgctcgcgaatgcgggcgcgaccgccatcatcgtcggccattccgag
cgccgcgccgaccatggcgagggcgatgctttggtgcggcagaaggcggaagccgcctgg
cgggccggggtgacggcgatcgtctgcatcggcgagacgcaagcccagcgcgatgccggc
cagaccctggacatcctgcgcggccagctcgacggctcgctgccggacggctctaccgcg
gccaacctggtcgtggcctatgagcccgtctgggcaatcggcaccggcctgacccccaca
gtccaggatgtcgagcagattcatgggtttatccgggagttcctgacctcccggtttagc
gtggacggggcgaagatgcggatcctctatggcggttcggtcaagccctcgaacgcggcc
gagctgatggccgtgaagaacgtcaacggagctctggtcggcggcgccagcctcaaggcg
gccgatttccttgcgatcgccaagggctgcccctag

DBGET integrated database retrieval system