KEGG   Bradyrhizobium diazoefficiens USDA 110: bll5351Help
Entry
bll5351           CDS       T00109                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     bll5351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(5899686..5900450)
Genome map
AA seq 254 aa AA seqDB search
MNCVPLGERTIMKVLPLLVVAMGVVAWEATAQDAQCVRERVAMVEAIRAYARSAAGVLGQ
QGLSEKVLEAVAQTKRHLFIPEQSCSIAYADRPIPIGLGQTISQPYIVALMTQLAEVAPD
HVVLEVGTGSGYQAAILAQLARKVCSIEIIPQLAETAAKTLRDLAYDNVSVRLGDGYDGW
PECGPFDAVVVTAALGEPPPPLIEQLKVGGRLVMPVGPGYGTQQLTVVEKIAPGKTTTRA
VALVRFVPFTRSQN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgaattgtgtccctcttggagagcgcacgatcatgaaggtcttgccactgctcgtggtc
gccatgggtgtcgtcgcgtgggaagcgaccgcacaggacgcacaatgcgtccgcgaacgc
gtcgccatggtcgaggccatccgggcctacgcccggtccgctgccggtgttttgggacag
caaggcttgtcggagaaggtccttgaggccgtggcgcaaacgaaacgccacctgttcatc
cctgagcaatcttgctctatcgcatacgccgatagaccgataccaatcggcctcggccag
accatatcgcagccgtacattgtggccttgatgacccagttggccgaggtcgcgcccgat
cacgttgtgctcgaagtcggtaccggttcgggctaccaggccgccatcctcgcgcagctc
gcgcgaaaggtctgcagcatcgagatcatcccgcaattggccgagaccgccgcgaaaaca
ctaagggacctcgcgtatgacaacgtgagcgtcaggcttggcgatggctacgatggctgg
cccgaatgtggtccttttgacgcagtcgtcgtgactgccgcgctcggggagccaccgccg
ccgctgatcgagcagcttaaagtaggtggccgactcgtcatgccggtgggccccggttac
ggcacccagcagctcacggtcgtcgaaaaaatcgctcctggcaagacgacgacgcgcgcc
gtcgccctcgtgcggtttgtcccgtttacgcgttcgcaaaactag

DBGET integrated database retrieval system