KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6010Help
Entry
bll6010           CDS       T00109                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    bll6010
Enzymes [BR:bja01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     bll6010
Peptidases [BR:bja01002]
 Cysteine Peptidases
  Family C44
   bll6010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6610335..6612173)
Genome map
AA seq 612 aa AA seqDB search
MCGIAGIVNLRGSAVEPDDISRLTGLIAHRGPFGQGTWFSADRSLAFGHRRLAIIDPGEG
GYQPMRSADGRHVIVFNGEIYNFLELRRELEAQGVVFRSQSDTEVILAAWQAWREDMLPR
FNGMWALAIFDTATGELFLARDRFGIKPLLYAVSPERFIFASEQRALVRSGLIDASVDVE
VARRLLLDAFGIEGSERTLFRQVRRLQGGHCMWLRQGKVSVRRWWRTVDHLPPVPGTEAE
QVARFRELFQDAVALRMRSDVPIGTCLSGGFDSSAVICTMAAHEKAGMGPRDSTAWRHAF
VATFPGALNDERPMAEEAAAWAEVAPTFLEIGQADALIDLDQILDDLDDVYIALPSAIWL
IYRQLRRQDVTVSLDGHGADELMGGYLQQGQALAFRIRNAAEDFASRSALARRSVDVLRM
LALKRRGVYFLRGGLRDLPASLPLVAEDDVLPREWGGLNRRLYRMFHSTVLPTILRNFDR
LSMAHGVEVRMPFMDWRLVTYTMALPESSKSSEGYTKAVARRAMANLMPESIRTARRKVG
FNSPMPEWLNGPLAGWTADLLDRKVPAFAELVDEAALRTTVSRLTASKSWDWEAVGRIWP
YLNMKWMLARYA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgcaggaatcgtcaatttgcgcggcagcgcggtcgagccggacgatatc
tcgcggctgaccggcctgatcgcgcatcgtggtccgttcggccaggggacctggttcagc
gcggaccgaagcctagcattcggccaccgccgcctcgccatcattgatcccggcgagggc
ggctaccagccgatgcggtctgcggacggccgtcacgtcatcgtcttcaacggcgagatc
tacaattttctcgagttgcgccgcgagctcgaggcgcagggcgtggtgttccgcagccaa
tcggataccgaagtgatcctggccgcctggcaagcgtggcgggaagacatgctgccgcgc
ttcaacggcatgtgggccttggcgatcttcgacacggccactggcgaactgtttctcgcg
cgcgatcggttcggcatcaagccgctgctctatgccgtgtcgccggagcggttcatcttc
gcgtccgagcagcgcgcgctggtgcggagcgggctgatcgatgcttccgtcgatgtggag
gtcgcgcgccggctactgctcgatgccttcgggatcgaaggaagcgagcggaccctgttt
cggcaggttcgccgcctgcagggcggccactgcatgtggctgcgccagggcaaggtcagt
gtcaggcgctggtggcggaccgtggatcatctgccgcccgtgcccggcaccgaagccgaa
caggtcgcgcgctttcgcgagctgttccaggatgccgtggccctgcgcatgcgcagcgat
gtgccgatcggaacgtgcctgtccggaggcttcgattcatcggcggtgatctgcaccatg
gcggcgcacgagaaggcgggcatggggccgcgcgacagcactgcatggcgccacgccttt
gtcgcgacgttccccggcgccttgaacgacgagcggccgatggccgaggaggccgccgcc
tgggctgaggttgcgccgaccttcctcgagatcgggcaggccgatgcgctcatagacctc
gaccagattctcgacgatctcgatgacgtctatatcgcgcttcccagcgcaatatggttg
atctatcggcagttgagacggcaagacgtgaccgtgtcgctggacggccacggtgcggac
gaactgatgggcggctatttgcagcagggacaggcgctcgcatttcgaattcgaaacgcc
gccgaagacttcgcctcgcgttcggcgctggcccggcgcagcgtggatgtcctgcgcatg
ttggccctgaagcgcaggggcgtctattttctgcgtggcggtctgcgcgatcttccggcc
tcgcttccgctggtggcggaggacgatgtgctgccgcgtgaatgggggggcttgaaccgg
cggctataccgaatgtttcacagtacggtgctgcctacgatcctgcgtaacttcgatcgt
ctttcgatggcccacggcgtcgaagtccgtatgcccttcatggactggcgcctggtgacc
tacacgatggcgcttcccgaaagcagcaagtcgtcggagggctataccaaggccgtcgcc
cggcgggcgatggccaacctgatgccggaatcgatccgcaccgcgcgtcgcaaggtcggc
ttcaattcgccgatgccggaatggttgaatgggccgctggccggctggacggccgacctg
ctcgaccgcaaggtgccggcgtttgccgaactggtggatgaagcggccctgcgcacgacg
gtgagccgcttgacggcgtcgaagtcctgggactgggaggcggtcgggcggatctggccg
tatttgaacatgaaatggatgttggcgaggtacgcgtaa

DBGET integrated database retrieval system