KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6122Help
Entry
bll6122           CDS       T00109                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00220  Arginine biosynthesis
bja00330  Arginine and proline metabolism
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01130  Biosynthesis of antibiotics
bja01230  Biosynthesis of amino acids
Module
bja_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    bll6122
   00330 Arginine and proline metabolism
    bll6122
Enzymes [BR:bja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     bll6122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 1048019
NCBI-ProteinID: NP_772762
RhizoBase: bll6122
UniProt: Q89H72
Position
complement(6735813..6736790)
Genome map
AA seq 325 aa AA seqDB search
MTDRTMPDRARRIALLGAPIDMGASQRGTLMGPPALRTAGLATLLESLDFEVVDYGDLSV
AEVRDLADRPPEKANHYREIQRWTRVLSRRGYEIAKTGALPIFLGGDHTLSMGSVNAMAR
HWQERGRELFVLWLDAHADYNTPETTITANMHGMSAAFLCGEPGLDGLLGDDPRASIDPD
RLDLFGARSIDKLEKELMRARRIRVVDMRQIDEFGVAVLIRRVIERVKASNGVLHVSFDV
DFLDPCVAPGVGTTVPGGATYREAHLIMELLHDSGVVGSVDIVELNPFLDERGRTARTAV
ELIGSLFGQQITDRPTPSNAIAPGE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcggaccatgccggatcgagcccggcgcatcgccttgctcggcgcgcccatc
gatatgggggcctcgcagcgcggcaccctgatgggcccgccggcgctgcgcaccgccggc
cttgcgacgctgctcgagagcctggacttcgaggtcgtcgattacggcgatctttcggtg
gccgaggtcagggacctcgctgacaggccgcccgaaaaagccaatcattaccgcgaaatc
cagcgctggacacgcgtgctgagccgcagaggttacgagatcgcgaaaaccggtgcgctt
ccgatcttcctcggcggcgatcacacgctgtcgatgggctcggtcaatgccatggcgcgc
cattggcaggagcgcggacgcgagctgttcgtgctctggctcgatgcgcatgccgactac
aatacgccggagacgacgatcacggcgaacatgcatggcatgtcggccgcgtttctgtgt
ggcgagccgggcctcgacggcctgctcggcgatgacccgcgtgcgtcgatcgatcctgac
aggctcgatctgttcggcgcgcggtcgatcgacaagctcgaaaaggagctgatgcgcgca
cgccggatcagggttgtcgacatgcgccagatcgacgagttcggcgtcgccgtgctgatc
cgccgtgtcatcgagcgggtcaaggcgagcaatggcgtgctgcatgtcagcttcgatgtc
gatttcctcgatccatgcgtggcgcccggggtcggaaccacggtgccgggcggagcgacc
tatcgcgaggcacatctgatcatggagctgctgcacgattccggcgtggtggggtcggtc
gacatcgttgagctcaatccattcctggacgaacgtggtcgaaccgcgcggaccgcggtc
gagctgatcggcagcctgttcgggcagcagatcaccgaccggccgacgccgagcaatgcg
atcgcgccgggcgagtga

DBGET integrated database retrieval system