KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6122Help
Entry
bll6122           CDS       T00109                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bll6122
  Amino acid metabolism
   00330 Arginine and proline metabolism
    bll6122
Enzymes [BR:bja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     bll6122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6735813..6736790)
Genome map
AA seq 325 aa AA seqDB search
MTDRTMPDRARRIALLGAPIDMGASQRGTLMGPPALRTAGLATLLESLDFEVVDYGDLSV
AEVRDLADRPPEKANHYREIQRWTRVLSRRGYEIAKTGALPIFLGGDHTLSMGSVNAMAR
HWQERGRELFVLWLDAHADYNTPETTITANMHGMSAAFLCGEPGLDGLLGDDPRASIDPD
RLDLFGARSIDKLEKELMRARRIRVVDMRQIDEFGVAVLIRRVIERVKASNGVLHVSFDV
DFLDPCVAPGVGTTVPGGATYREAHLIMELLHDSGVVGSVDIVELNPFLDERGRTARTAV
ELIGSLFGQQITDRPTPSNAIAPGE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcggaccatgccggatcgagcccggcgcatcgccttgctcggcgcgcccatc
gatatgggggcctcgcagcgcggcaccctgatgggcccgccggcgctgcgcaccgccggc
cttgcgacgctgctcgagagcctggacttcgaggtcgtcgattacggcgatctttcggtg
gccgaggtcagggacctcgctgacaggccgcccgaaaaagccaatcattaccgcgaaatc
cagcgctggacacgcgtgctgagccgcagaggttacgagatcgcgaaaaccggtgcgctt
ccgatcttcctcggcggcgatcacacgctgtcgatgggctcggtcaatgccatggcgcgc
cattggcaggagcgcggacgcgagctgttcgtgctctggctcgatgcgcatgccgactac
aatacgccggagacgacgatcacggcgaacatgcatggcatgtcggccgcgtttctgtgt
ggcgagccgggcctcgacggcctgctcggcgatgacccgcgtgcgtcgatcgatcctgac
aggctcgatctgttcggcgcgcggtcgatcgacaagctcgaaaaggagctgatgcgcgca
cgccggatcagggttgtcgacatgcgccagatcgacgagttcggcgtcgccgtgctgatc
cgccgtgtcatcgagcgggtcaaggcgagcaatggcgtgctgcatgtcagcttcgatgtc
gatttcctcgatccatgcgtggcgcccggggtcggaaccacggtgccgggcggagcgacc
tatcgcgaggcacatctgatcatggagctgctgcacgattccggcgtggtggggtcggtc
gacatcgttgagctcaatccattcctggacgaacgtggtcgaaccgcgcggaccgcggtc
gagctgatcggcagcctgttcgggcagcagatcaccgaccggccgacgccgagcaatgcg
atcgcgccgggcgagtga

DBGET integrated database retrieval system