KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6243Help
Entry
bll6243           CDS       T00109                                 

Gene name
hutI
Definition
(RefSeq) imidazolonepropionase
  KO
K01468  
imidazolonepropionase [EC:3.5.2.7]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Histidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    bll6243 (hutI)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     bll6243 (hutI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6865939..6867153)
Genome map
AA seq 404 aa AA seqDB search
MAERFDRIWHNARLATMRADRPDLGEIEHGLIAARGGHIVYAGAAADFPADADAIKRIDC
AGRWITPGLVDCHTHLVYGGNRAHEFELRLKGASYEEIARAGGGIVSTVAATRKASEAEL
VASALPRLDALIGEGATTVEIKSGYGLDAETEMRQLAAARSLGRQRPVAIRTSFLGAHAL
PPEADGDKDRYIDLVCKEMLPAVAKAGLADAVDTFMEGIAFSAGQTARVFETARGLGLPV
KLHADQLSNLGGAALAAKFSALSADHLEHTDEAGAAAMAKAGTVAVLLPGAFYFIRETQK
PPVESFRKHGVHMALASDCNPGSSPLTSLLLAMNMGATLFRMTVAECLAGVTREGAHALG
VLDETGTLEAGKWCDLAIWDIERPAELVYRIGFNPLHRRVWRGQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgcttcgaccggatctggcacaatgcccgcctcgccacgatgcgggccgat
cgccccgatctcggcgaaatcgagcacggcctgattgccgcgcgcggcggccacatcgtc
tatgcgggtgcggcggcggactttccggcggacgcagatgccatcaagcggatcgattgc
gcggggcgctggatcacgccgggcctcgtcgactgccacactcatctggtctatggcggc
aaccgtgcgcacgagttcgagctgcggctgaagggggcaagctatgaggagatcgcgcgc
gccggcggcggcatcgtctcgacggtggccgcgacgcgcaaggcgagcgaggccgagctc
gtcgcaagcgcgctgccgcggctcgacgcgctgatcggcgagggcgccaccacggtcgag
atcaagtccggctacggcctcgatgccgagaccgagatgcgtcagctcgcagctgcgcgc
agcctcggccgccagcggccggttgcgatccgcacgtccttcctcggcgcccatgcgctg
ccgcccgaggcggatggtgacaaggatcgctatatcgatctcgtgtgcaaggagatgctg
cccgcggttgccaaggctggtcttgccgatgccgtcgacaccttcatggagggcatcgcg
ttttccgccgggcagaccgcgcgggtgttcgagacggcgaggggactcgggctgccggtg
aagcttcatgccgaccaattgtcgaacctcggcggtgccgcgctcgctgccaaattctcc
gcactgtcggccgatcatctcgagcataccgatgaagcaggtgcggccgcgatggcgaag
gcgggaacggtggctgtgctgttgccgggcgccttctatttcatccgcgagacgcagaag
ccgccggtcgagtcgttccgcaagcacggcgtccacatggcgctggcgtcggactgcaat
cccggtagctcgccgctgacctcgctgctgctggcgatgaacatgggcgcgacgctgttc
cggatgacagtggccgaatgcctcgccggcgtcacccgcgaaggcgcgcacgcgcttggc
gtgctcgatgaaaccgggacgttagaggccggcaaatggtgcgatctcgcgatctgggac
atcgagcggcccgccgagctcgtttaccgcatcggcttcaatccgctgcaccgccgggtt
tggagggggcaatga

DBGET integrated database retrieval system