KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6732Help
Entry
bll6732           CDS       T00109                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    bll6732
  Metabolism of other amino acids
   00480 Glutathione metabolism
    bll6732
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     bll6732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7417116..7417592)
Genome map
AA seq 158 aa AA seqDB search
MSAIYDFKANSLLGEEVPMRRFEGQVLLIVNTASKCGFTPQYRGLEDLYRDLSPRGFAVL
GFPCNQFGAQEPGQASEIQEFCSTNYDVTFPLFEKIDVNGANAHPLYEYLKRQQSGLLGA
SIKWNFTKFLVDRAGRVIARYAPTARPEGLRQQIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgatttacgacttcaaggccaactcgctgctcggcgaggaagtgcccatgcgc
cggttcgaagggcaggtgctcctgatcgtcaacaccgcgagcaaatgcggcttcacgccg
caatatcgcggccttgaggatctctaccgcgatctctcgccgcgcggcttcgcggtgctc
ggctttccctgcaaccagttcggcgcgcaggagccggggcaggcgagcgagatccaggaa
ttctgctcgaccaattacgacgtcacctttcccctgttcgagaagatcgacgtcaacggc
gccaacgcgcatcccttgtatgagtatctgaaacgccagcaatccgggctcctcggcgcc
tccatcaaatggaatttcaccaaattcctggtggaccgtgccggccgggtgatcgcgcgc
tacgcgccgaccgcgcggcccgaaggattgcggcagcaaatcgagaccctgttatga

DBGET integrated database retrieval system