KEGG   Bradyrhizobium japonicum USDA110: bll6732Help
Entry
bll6732           CDS       T00109                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bja00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bja00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7417116..7417592)
Genome map
AA seq 158 aa AA seqDB search
MSAIYDFKANSLLGEEVPMRRFEGQVLLIVNTASKCGFTPQYRGLEDLYRDLSPRGFAVL
GFPCNQFGAQEPGQASEIQEFCSTNYDVTFPLFEKIDVNGANAHPLYEYLKRQQSGLLGA
SIKWNFTKFLVDRAGRVIARYAPTARPEGLRQQIETLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgatttacgacttcaaggccaactcgctgctcggcgaggaagtgcccatgcgc
cggttcgaagggcaggtgctcctgatcgtcaacaccgcgagcaaatgcggcttcacgccg
caatatcgcggccttgaggatctctaccgcgatctctcgccgcgcggcttcgcggtgctc
ggctttccctgcaaccagttcggcgcgcaggagccggggcaggcgagcgagatccaggaa
ttctgctcgaccaattacgacgtcacctttcccctgttcgagaagatcgacgtcaacggc
gccaacgcgcatcccttgtatgagtatctgaaacgccagcaatccgggctcctcggcgcc
tccatcaaatggaatttcaccaaattcctggtggaccgtgccggccgggtgatcgcgcgc
tacgcgccgaccgcgcggcccgaaggattgcggcagcaaatcgagaccctgttatga

DBGET integrated database retrieval system