KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6765Help
Entry
bll6765           CDS       T00109                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bll6765
Enzymes [BR:bja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     bll6765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7451386..7453347)
Genome map
AA seq 653 aa AA seqDB search
MDLLAQAQIKGVQSEFVDALGKLRVTDPVALKSILDALPEKRVYRFVSGPVVVRALGHPR
TELAATGAPPLQWKIAGNGNVIAQGETREPVIAWPAGLPLGYHRLTLTDAEGVTEEVPMI
VAPERAFGGDFDRGWLLAVQLYGVRSERNWGIGDFTDLADLVRLAKQLGADGVGLNPLHV
LFDDHPADCSPYSPNSRLFLNPLYIDVEAIPEFSADLVPDAAATAARLREGDRVPYADMA
ALKWLALRAAFNSFVRSASGVRRNQFDAFRADRAPLLSRFACFEVLRHRFTGPWWEWPPE
WRQPDETKCARLRNGPDKREVEFVEFVQWTADSQLHAAKELAGQLGMRVGLYLDVAVGVQ
SNGFDAWNEQTAISRHLAVGAPPDVLNTVGQDWGLAGFNAGGLEAQSFVPFADMLAASMR
HAGAIRIDHVLGLKRLYLVPRGFKPDNGAYVQMPFEALLGAVARESAAHKCIVIGEDLGT
VPEGFRETMQDFGIWSYLVMMFERDDAGHFRNIDYYRPNALVTLNTHDLCTYAGWRSFSD
LKMKLSLGLDPGEDDKARWHALGMLDEILRQNGINANDLYSVLAFLSRTPSRLLAVSLED
LLGVIDQPNIPGTIDEHPNWRQRLPVTLDKIASKVDLTALRAATRERSLLGGS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttagctcaagcccagatcaagggtgttcagtccgaattcgtggacgccctc
ggaaagctgcgggtcaccgatcccgtggcgctcaaatccatcctcgacgccctgccggag
aagcgggtttatcgcttcgtcagcgggcccgtggtggttcgcgccctgggacatccgcgg
acggaattggcggccaccggcgctccgccgctgcaatggaaaatcgccggcaacggcaac
gtgatcgcacaaggcgagacgcgcgagcccgtcatcgcctggcccgccggcctgccgctc
ggctaccaccgcttgacgctgaccgatgccgagggcgtgaccgaagaggtgccgatgatc
gtggcgccagagcgcgccttcggcggcgatttcgaccgcggctggctgctcgccgtgcag
ctctacggcgtccgctcggagcgcaactggggcatcggcgatttcaccgaccttgccgat
ctcgtccggctcgcaaaacagctcggggccgacggcgtcggcctcaatccgctgcacgtg
ttgttcgacgaccacccggccgattgcagcccctattcgccgaacagccggctgtttctc
aatccgctctacatcgacgtcgaggcgatcccggaattttccgcggacctcgtccccgat
gcggccgcgaccgccgcgcggctgcgcgaaggcgatcgcgtcccctatgccgacatggcg
gcgctgaaatggctcgccctgcgcgctgcctttaacagcttcgtgcggagcgcgagcggc
gtccgccgcaatcagttcgacgccttccgcgcggaccgcgcgccgctgttgtcccgcttt
gcctgcttcgaggtgctgcggcatcgcttcaccgggccgtggtgggaatggccgcccgag
tggcggcagcccgacgagacaaaatgcgcccggctgcgcaacggtcctgacaagcgcgag
gtcgagttcgtcgaattcgtgcaatggaccgccgatagccaattgcacgcggccaaggag
ctggccggccagctcggcatgcgggtcgggctttatctcgacgttgccgtcggcgtgcag
tccaacggcttcgatgcctggaacgagcagacggcgatttcgcgccatctcgccgtcggc
gcgccgcccgacgtgctcaacacggtcggccaggactggggtcttgccggcttcaatgcc
ggcggcctggaggcgcaatccttcgtgccgttcgccgacatgctggccgcctcgatgcgc
catgccggcgccatccggatcgatcacgtgctcgggctgaagcggctctatctcgtgccg
cgcggcttcaagcccgacaacggcgcctatgtgcagatgccgttcgaggcgctgctgggc
gccgtggcgcgcgagagcgcggcccataagtgcatcgtgatcggcgaagacctcggcacg
gtgccggaaggttttcgcgagaccatgcaggatttcggcatctggtcctacctcgtcatg
atgttcgagcgcgacgatgccggccacttccgcaacatcgactattaccggccgaacgcg
ctggtgacgctgaacacgcacgacctctgcacctatgcgggttggcgctccttcagcgat
ctcaagatgaagctgtcgctcgggctcgatcccggcgaggacgacaaggcccgctggcat
gcgctcggcatgctcgatgagatcctgcgccagaacggcatcaacgccaacgatctctat
tcggtgctcgccttcctgtcgcgcacgccctcgcggctgctcgcggtgtcgctggaggat
ctgctcggcgtgatcgaccagcccaacattcccggcacgatcgacgagcatccgaactgg
cggcagcgcctgcctgtcacgctcgacaagatcgcctcgaaggtcgatctcacggccttg
agagcggcgacgcgggaacgttcgttgctcggcgggagttag

DBGET integrated database retrieval system