KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6833Help
Entry
bll6833           CDS       T00109                                 

Definition
(RefSeq) ABC transporter permease
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7531009..7531587)
Genome map
AA seq 192 aa AA seqDB search
MSTAEIHRQITADEIAHTFEEEATPKVDLGIYAFEDWVALAIFWVMALAVFLQFFTRYVL
NDSYAWTEEIATYCLIGVVFIGASMCVRLSRHIQVDLIYRYLPHLVARTLSTVIDLIRIA
FFGYAIKLVWVYIQIIGDESMTTINLPKDYVYYAVLAGFVLMFARSVQVALQHLRQGYSI
LERPGAYDGFEG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgccgaaatacaccggcagatcaccgcggacgagatcgcccacaccttcgag
gaggaggcgacgccgaaggtcgatctcggcatctacgctttcgaggactgggtggcgctg
gcgatcttctgggtgatggcgctcgccgtcttcctccagttcttcacccgctacgtcctc
aacgacagctatgcctggaccgaggagatcgcgacctactgcctaatcggcgtggtcttc
atcggcgcctcgatgtgcgtgcggctgtcgcggcacatccaggtcgatctgatctaccgt
tatctgccgcatctcgtcgcgcgcacgctgtcgacggtcatcgacctgatccggatcgcc
ttcttcggctacgccatcaagctggtctgggtctacatccagatcatcggcgacgagtcg
atgaccacgatcaatcttcccaaggactacgtctattacgccgtgctggccggcttcgtg
ctgatgttcgcgcgctcggtgcaggtggcgctgcaacatctgcgacagggctactcgatc
ctcgaacgtcccggcgcctacgacggttttgaagggtaa

DBGET integrated database retrieval system