KEGG   Bradyrhizobium diazoefficiens USDA 110: bll6925Help
Entry
bll6925           CDS       T00109                                 

Definition
(RefSeq) two-component response regulator
  KO
K19641  
two-component system, NtrC family, response regulator HupR/HoxA
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Two-component system
Module
HupT-HupR (hydrogenase synthesis regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bja00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    bll6925
Two-component system [BR:bja02022]
 NtrC family
  HupT-HupR [MD:M00772]
   bll6925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7621367..7622824)
Genome map
AA seq 485 aa AA seqDB search
MSIQGTILVVDDEVRSQEALRRVLREDFEVLCVGNATDAEKLLEGEIVHAILCDQRMPHE
SGVSFLKRVRELWPDPVRMIISGYSESEDIIAGLNEAGIYQYITKPWQPDQLVETVKEAV
QLYRLQKETETAGVDVKATSGHIKKVVSVKRGVAKQLYDFDRIVHSTESPMHAVIELGRR
AADYDISVLITGESGTGKELLARAIHYGSARANRAFVVENCGALPDELLESELFGCKKGA
FTGAYQDRIGLFEVADGGTIFLDEIGETSPAFQVKLLRVLQESEIRPLGAQRVRKVDVRV
VAATNRDLEAEVEAGRFRRDLYYRLAAFPVHMPALRERPMDIPLIAEGVLSAVKSSFNRP
NLRFARSALEEFGKYHWPGNVRELQNEIQRMAVLADRDELAAPPLLGRRNGKRSAPLPAH
GRLNGSASLKDKVEDLEKSVIMNCLERNDGNISRVASELGLSRVGLRNKLSRYDLRKNAK
GDAFS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgagcattcagggaaccattctcgtcgtcgacgacgaggtccgctcgcaggaagcgttg
cggcgcgtgctcagggaggatttcgaggtgctctgcgtcggcaacgcgaccgatgcggag
aagctgctggagggcgagatcgtccacgcgatcctctgcgaccagcggatgccgcacgaa
tccggcgtgagcttcctgaagcgcgtccgcgagctctggccggacccggtgcggatgatc
atttccggctattcggagtccgaggacatcatcgcgggactgaacgaggccggcatctat
caatacatcaccaaaccctggcagccggaccagctggtcgaaaccgtcaaggaggcggtt
cagctctatcggctgcagaaggagaccgagaccgccggcgtcgacgtcaaggcgacctcc
gggcacatcaagaaggtcgtctcggtcaagcgcggggtggccaagcagctctacgatttc
gaccgcatcgtgcattcgacggaaagcccgatgcacgccgtgatcgagctcggcaggcgc
gcagccgactacgatatctcggttctgatcaccggagaatccggcaccggcaaggagctt
ctggctcgcgcgatccattacggctcggcgcgggccaacagggcgttcgtggtcgagaac
tgcggcgcgctgccggacgagctcctggaaagcgagctgttcggttgcaagaagggcgcc
ttcaccggcgcctaccaggatcgcatcggcctgttcgaggtcgccgatggcggcacgatc
ttcctcgacgagatcggcgagacctcgccggcgttccaggtcaagctgctgcgtgtgctg
caggagagcgagatccggccgctcggcgcgcagcgcgtgcgcaaggtcgacgttcgcgtg
gtggcggcgaccaatcgcgacctggaggcggaggtcgaggccggccgcttccggcgcgac
ctgtactaccgcctcgccgcattcccggtgcacatgccggcgctgcgcgagcgcccgatg
gacatcccgctgattgcggagggcgtgctgtcggcggtcaagagttccttcaaccggccg
aatctgcgcttcgcgcgttcggcgctggaggaattcggcaaatatcactggccgggcaac
gtacgcgagctccagaacgagatccagcgcatggccgtgctcgccgaccgggacgagctg
gccgcgccaccgctgctcggccgccgcaacgggaagcgatccgcgccgctgccggcccac
ggcaggctgaacggatcggcctcgctgaaagacaaggtggaggatctcgagaagtcggtt
atcatgaactgcctggagaggaacgacggaaacatcagtcgtgtcgccagcgagctgggt
ctctcacgggtagggctcaggaacaagctgtccaggtatgatctgagaaaaaatgccaaa
ggcgacgcattctcctga

DBGET integrated database retrieval system