KEGG   Bradyrhizobium japonicum USDA110: bll7236Help
Entry
bll7236           CDS       T00109                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bja01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bja00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:bja00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7957098..7958075)
Genome map
AA seq 325 aa AA seqDB search
MALPGGAAGRDQESITLGEGCTPLVQQQWGDLRPLFKLEWFNPTGSFKDRGSAVMLSFLR
QIGVDAILEDSSGNGGSSMAGLGAAGGMRVKILAPASTSPAKIAQVRAYGAAVQLVEGPR
EESEADAIRQSSQTFYASHNWQPFFLEGTKSLAYEIWEDLGFRAPDNVIVPVGAGSSLLG
CAFGFRELLKAGQIAKLPRLFAAQPQNCSPIDASFKAGVDTPVAREVSKTIAEGTAIKNP
LRLREIIAALRESGGGTVALAEDEIVAALRRLARQGLFAEPTSASAAAALDKLSAAGAIK
ANETTVAVLTGTGLKAATIVADLVQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctaccgggcggcgctgccggtcgagatcaagaatcgatcacgctcggcgagggc
tgcacgccactggtgcagcagcagtggggcgacctgcgcccgctgttcaagctcgaatgg
ttcaacccgaccggcagcttcaaggaccgcggctcggcggtgatgctgtccttcctgcgg
cagatcggcgtcgacgccattctggaggactcttccggcaatggaggctcgtcgatggcg
gggttaggtgccgccggcggcatgcgcgtgaagatcctggcgccggcctcgacgtcgccg
gccaagatcgcgcaggtgcgcgcttacggcgcggcggtgcaactcgtcgaagggccacgc
gaggagtcggaggccgacgcgatccgccagtcgagccagactttttacgccagccacaac
tggcagccgttctttctcgaaggcaccaaatcgctcgcctatgaaatctgggaagacctc
ggcttccgcgcccccgacaacgtcatcgtccccgtcggcgccggcagcagcctgctcggt
tgcgccttcggcttccgcgagctgctgaaggccggccagatcgcgaagctgccgcgcctg
ttcgcggcacagccgcagaactgctcgccgatcgatgcgagcttcaaggccggcgtcgat
acgccggtcgcgcgcgaggtgagcaagaccatcgccgagggcaccgcgatcaagaatccc
ctgcgtctgcgcgagatcatcgccgccttgcgcgagagcggcggcggcaccgtggcgctc
gccgaggacgagatcgtcgccgccctgcgacgacttgcacggcaaggcctgtttgccgag
ccgaccagcgccagcgcagccgccgcgctggacaagctctccgccgctggcgccatcaag
gcgaacgagaccacggtcgcggtgctcaccggcacggggctgaaggccgccacaatcgtt
gccgatctcgtgcagtag

DBGET integrated database retrieval system