KEGG   Bradyrhizobium diazoefficiens USDA 110: bll7236Help
Entry
bll7236           CDS       T00109                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    bll7236
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bll7236
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    bll7236
Enzymes [BR:bja01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     bll7236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7957098..7958075)
Genome map
AA seq 325 aa AA seqDB search
MALPGGAAGRDQESITLGEGCTPLVQQQWGDLRPLFKLEWFNPTGSFKDRGSAVMLSFLR
QIGVDAILEDSSGNGGSSMAGLGAAGGMRVKILAPASTSPAKIAQVRAYGAAVQLVEGPR
EESEADAIRQSSQTFYASHNWQPFFLEGTKSLAYEIWEDLGFRAPDNVIVPVGAGSSLLG
CAFGFRELLKAGQIAKLPRLFAAQPQNCSPIDASFKAGVDTPVAREVSKTIAEGTAIKNP
LRLREIIAALRESGGGTVALAEDEIVAALRRLARQGLFAEPTSASAAAALDKLSAAGAIK
ANETTVAVLTGTGLKAATIVADLVQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctaccgggcggcgctgccggtcgagatcaagaatcgatcacgctcggcgagggc
tgcacgccactggtgcagcagcagtggggcgacctgcgcccgctgttcaagctcgaatgg
ttcaacccgaccggcagcttcaaggaccgcggctcggcggtgatgctgtccttcctgcgg
cagatcggcgtcgacgccattctggaggactcttccggcaatggaggctcgtcgatggcg
gggttaggtgccgccggcggcatgcgcgtgaagatcctggcgccggcctcgacgtcgccg
gccaagatcgcgcaggtgcgcgcttacggcgcggcggtgcaactcgtcgaagggccacgc
gaggagtcggaggccgacgcgatccgccagtcgagccagactttttacgccagccacaac
tggcagccgttctttctcgaaggcaccaaatcgctcgcctatgaaatctgggaagacctc
ggcttccgcgcccccgacaacgtcatcgtccccgtcggcgccggcagcagcctgctcggt
tgcgccttcggcttccgcgagctgctgaaggccggccagatcgcgaagctgccgcgcctg
ttcgcggcacagccgcagaactgctcgccgatcgatgcgagcttcaaggccggcgtcgat
acgccggtcgcgcgcgaggtgagcaagaccatcgccgagggcaccgcgatcaagaatccc
ctgcgtctgcgcgagatcatcgccgccttgcgcgagagcggcggcggcaccgtggcgctc
gccgaggacgagatcgtcgccgccctgcgacgacttgcacggcaaggcctgtttgccgag
ccgaccagcgccagcgcagccgccgcgctggacaagctctccgccgctggcgccatcaag
gcgaacgagaccacggtcgcggtgctcaccggcacggggctgaaggccgccacaatcgtt
gccgatctcgtgcagtag

DBGET integrated database retrieval system