KEGG   Bradyrhizobium diazoefficiens USDA 110: bll7367Help
Entry
bll7367           CDS       T00109                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
bja00010  Glycolysis / Gluconeogenesis
bja00620  Pyruvate metabolism
bja00640  Propanoate metabolism
bja00680  Methane metabolism
bja01100  Metabolic pathways
bja01110  Biosynthesis of secondary metabolites
bja01120  Microbial metabolism in diverse environments
bja01130  Biosynthesis of antibiotics
bja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    bll7367
   00620 Pyruvate metabolism
    bll7367
   00640 Propanoate metabolism
    bll7367
  Energy metabolism
   00680 Methane metabolism
    bll7367
Enzymes [BR:bja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     bll7367
Lipid biosynthesis proteins [BR:bja01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   bll7367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 1054602
NCBI-ProteinID: NP_774007
RhizoBase: bll7367
UniProt: Q89DS2
Position
complement(8103919..8105607)
Genome map
AA seq 562 aa AA seqDB search
MAGTLIAKTRFALSPGHDAKTVETRAMLTEAKTYDELYRNFRWDIPARFNMAEACCDRHA
DGTGRLALIYVDENGATTRTSFDEVAEMSRRFANVLKADGLARGDRVAVFLSQSLELPIA
HMAAFRSGLISIPLFALFGEDALEFRLSNSQARAIITDEAGWEKLTRVRDRLPYLQDIYV
TSGAVHAGAKPFWPAIETASEDFATVDTSADDPALIIYTSGTTGNPKGALHAHRVVLGHL
PNVEMCHNFLPRPGDLMWTPADWAWIGGLVNGLLAFWYHGIPLVGHRARKFEPQAAMQMM
ADLSVRNVFLPPTALKLMRQAGVKHPGVKLRSIFTGGESLGGELLGWVRETFGIDAHEVF
GQTECNLVIGSNSNLFPIRPGAMGKATPGFDVRIVNDKGEEQPRGQRGIIGVRQPCPVTM
LEYWRNPEATRKKYAGDFLLTGDLGVQDEDGYFWYVSREDDVITTAGYRVGPSEIEHTLM
KHPSVAMAAVVGIPDPIRTESIKAWIVLRPGFTGSDALAREIQEFVKVQLAAHEYPRFVE
FAETLPMTATGKVLRRELRAKG
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggccgggactttgatcgcgaagacgcgcttcgcgctttcgcccggccatgacgccaag
accgtggaaacgcgagccatgctcaccgaagccaagacctacgacgagctctatcgcaac
ttccgctgggatatcccggcgcgcttcaacatggcggaggcgtgctgcgaccgccatgcc
gacggtaccggccgtctcgcgctgatctatgtcgacgagaacggcgccaccacgcgcacc
tccttcgacgaggtcgcggagatgtcgcgccgcttcgccaacgtgctgaaggcggatggc
cttgcgcgcggcgaccgcgtcgcggtgttcctgtcgcagtcgctggagctgcctatcgcg
catatggcggcgttccgctccgggctgatctcgatccctctgttcgcgctgttcggcgag
gacgcgctggaatttcgcctgtcgaattcgcaagcaagagccatcatcactgatgaggcg
ggctgggagaagctcacgagggtccgcgatcggctgccctatttgcaggacatctatgtc
acgagcggcgccgtccacgccggcgcaaaaccgttctggccggcgatcgaaaccgcgtcc
gaggattttgcgaccgtcgacacctcggccgacgatcctgcgctgatcatctacacctcg
ggcacaacgggcaatccgaagggagcgctgcatgcgcatcgcgtcgtgctcggccatctg
ccgaacgtcgagatgtgccacaacttcctgccgcgccccggcgatctgatgtggacgccg
gcggactgggcctggatcggcggcctcgtcaacggcctgctcgcgttctggtatcacggc
attcccctggtcggtcaccgcgcccgaaaattcgagccgcaggcggcgatgcagatgatg
gccgatctttccgtccgcaacgtcttcctgccgccgacggcgctgaagctgatgcggcag
gccggcgtgaagcatcccggcgtcaagctgcgcagcattttcaccggcggcgaatcgctc
ggcggcgaactcttgggctgggtgcgcgagaccttcggcatcgacgcgcacgaagtattc
ggccagaccgagtgcaatctcgtgatcggcagcaactccaacctgtttccgatccggccc
ggcgcgatgggcaaggcgacgccgggcttcgacgtccgcatcgtcaacgacaagggcgag
gagcagccgcgcgggcagcgcggcatcatcggcgtgcgccagccgtgccccgtcaccatg
ctcgaatactggcgcaatccggaggcgacgcgtaagaaatatgccggcgacttcctgctc
accggcgatctcggcgtgcaggacgaggacggctatttctggtatgtcagccgcgaggac
gacgtcatcaccaccgccggctatcgcgtcggcccatccgagatcgagcacacgctgatg
aagcatccgtcggtggcgatggccgcggtggtcggtattcccgatccgatccgcacggag
tcgatcaaggcctggatcgtgctgcgtccgggctttaccggcagcgacgcgctcgcgcgc
gagatccaggagttcgtgaaggtgcagctcgccgcgcacgaatatccgcgcttcgtggag
ttcgccgagacgctgccgatgacggcgaccggcaaggtgctgcggcgcgaactgcgggcg
aagggttag

DBGET integrated database retrieval system