KEGG   Bradyrhizobium japonicum USDA110: bll7367Help
Entry
bll7367           CDS       T00109                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bja01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bja00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bja00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bja00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bja00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(8103919..8105607)
Genome map
AA seq 562 aa AA seqDB search
MAGTLIAKTRFALSPGHDAKTVETRAMLTEAKTYDELYRNFRWDIPARFNMAEACCDRHA
DGTGRLALIYVDENGATTRTSFDEVAEMSRRFANVLKADGLARGDRVAVFLSQSLELPIA
HMAAFRSGLISIPLFALFGEDALEFRLSNSQARAIITDEAGWEKLTRVRDRLPYLQDIYV
TSGAVHAGAKPFWPAIETASEDFATVDTSADDPALIIYTSGTTGNPKGALHAHRVVLGHL
PNVEMCHNFLPRPGDLMWTPADWAWIGGLVNGLLAFWYHGIPLVGHRARKFEPQAAMQMM
ADLSVRNVFLPPTALKLMRQAGVKHPGVKLRSIFTGGESLGGELLGWVRETFGIDAHEVF
GQTECNLVIGSNSNLFPIRPGAMGKATPGFDVRIVNDKGEEQPRGQRGIIGVRQPCPVTM
LEYWRNPEATRKKYAGDFLLTGDLGVQDEDGYFWYVSREDDVITTAGYRVGPSEIEHTLM
KHPSVAMAAVVGIPDPIRTESIKAWIVLRPGFTGSDALAREIQEFVKVQLAAHEYPRFVE
FAETLPMTATGKVLRRELRAKG
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggccgggactttgatcgcgaagacgcgcttcgcgctttcgcccggccatgacgccaag
accgtggaaacgcgagccatgctcaccgaagccaagacctacgacgagctctatcgcaac
ttccgctgggatatcccggcgcgcttcaacatggcggaggcgtgctgcgaccgccatgcc
gacggtaccggccgtctcgcgctgatctatgtcgacgagaacggcgccaccacgcgcacc
tccttcgacgaggtcgcggagatgtcgcgccgcttcgccaacgtgctgaaggcggatggc
cttgcgcgcggcgaccgcgtcgcggtgttcctgtcgcagtcgctggagctgcctatcgcg
catatggcggcgttccgctccgggctgatctcgatccctctgttcgcgctgttcggcgag
gacgcgctggaatttcgcctgtcgaattcgcaagcaagagccatcatcactgatgaggcg
ggctgggagaagctcacgagggtccgcgatcggctgccctatttgcaggacatctatgtc
acgagcggcgccgtccacgccggcgcaaaaccgttctggccggcgatcgaaaccgcgtcc
gaggattttgcgaccgtcgacacctcggccgacgatcctgcgctgatcatctacacctcg
ggcacaacgggcaatccgaagggagcgctgcatgcgcatcgcgtcgtgctcggccatctg
ccgaacgtcgagatgtgccacaacttcctgccgcgccccggcgatctgatgtggacgccg
gcggactgggcctggatcggcggcctcgtcaacggcctgctcgcgttctggtatcacggc
attcccctggtcggtcaccgcgcccgaaaattcgagccgcaggcggcgatgcagatgatg
gccgatctttccgtccgcaacgtcttcctgccgccgacggcgctgaagctgatgcggcag
gccggcgtgaagcatcccggcgtcaagctgcgcagcattttcaccggcggcgaatcgctc
ggcggcgaactcttgggctgggtgcgcgagaccttcggcatcgacgcgcacgaagtattc
ggccagaccgagtgcaatctcgtgatcggcagcaactccaacctgtttccgatccggccc
ggcgcgatgggcaaggcgacgccgggcttcgacgtccgcatcgtcaacgacaagggcgag
gagcagccgcgcgggcagcgcggcatcatcggcgtgcgccagccgtgccccgtcaccatg
ctcgaatactggcgcaatccggaggcgacgcgtaagaaatatgccggcgacttcctgctc
accggcgatctcggcgtgcaggacgaggacggctatttctggtatgtcagccgcgaggac
gacgtcatcaccaccgccggctatcgcgtcggcccatccgagatcgagcacacgctgatg
aagcatccgtcggtggcgatggccgcggtggtcggtattcccgatccgatccgcacggag
tcgatcaaggcctggatcgtgctgcgtccgggctttaccggcagcgacgcgctcgcgcgc
gagatccaggagttcgtgaaggtgcagctcgccgcgcacgaatatccgcgcttcgtggag
ttcgccgagacgctgccgatgacggcgaccggcaaggtgctgcggcgcgaactgcgggcg
aagggttag

DBGET integrated database retrieval system