KEGG   Bradyrhizobium diazoefficiens USDA 110: bll7739Help
Entry
bll7739           CDS       T00109                                 

Gene name
pldB
Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    bll7739 (pldB)
Enzymes [BR:bja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     bll7739 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(8484864..8485811)
Genome map
AA seq 315 aa AA seqDB search
MTLISIPSNPVPEDVVSGTIKTPDGAELRFARWAPPANRKGTVCVFTGRSEQIEKYFETV
RDLRDRGFAVAMIDWRGQGHSSRRLRDPRKGYVRDFADFEIDVETFVQQVVLPDCPPPFF
ALAHSMGGTVLLRVAHAGKRWFDRMVLSAPMIDLPGRTTSFPSRALLKTMRLMGMGGRYV
PGGSDRITGLDPFINNPLTSDPVRYARNAAILEEDPTLGLASPTVAWADSAFRAMHTFKG
MNYPSEIRQPILMLAASSDTVVSTAAIEEFAYHLRAGSHLVIAGSKHEILQEQDRYRSQF
WAAFDAFVPGTPLFK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgatctcgattccgtccaatcccgttcccgaagacgtcgtcagcggcaccatc
aagacacccgatggcgccgagctgcgctttgcgcgctgggcgccgccggcgaaccgcaag
ggcacggtctgcgtcttcaccggacgcagcgagcagatcgagaaatatttcgagaccgtg
cgcgacctgcgcgaccgcggctttgcggtggcgatgatcgactggcgcgggcagggccac
tcctcgcgccgcctgcgcgatccgcgcaagggctatgtgcgcgacttcgccgatttcgaa
atcgacgtcgagaccttcgtgcagcaggtggtgctgccggattgcccgccgcccttcttc
gcgctcgcccactccatgggcggtacggtgttgctgcgcgttgcgcatgcgggcaagcgc
tggttcgaccgcatggtgctgtcggcgccgatgatcgacctgccaggccgcaccacctcg
tttccgtcgcgggcgcttctgaagacgatgcgcctgatggggatgggcggccgctatgtt
cccggcggcagcgaccgcatcaccgggctcgatcccttcatcaacaatcccctgaccagc
gatcccgtgcgttatgcgcgcaacgccgcgatcctggaggaggatccgacgctcgggctg
gcgtcaccgacggtcgcctgggccgatagcgccttccgcgccatgcacaccttcaagggc
atgaactacccctccgagatccgccagccgatcctgatgctggcggcctccagcgacacc
gtggtttcgaccgccgcgatcgaggagttcgcctaccatttgcgcgccggctcccatctc
gtgatcgccggctcgaagcacgagatcctccaggagcaggaccgctaccgctcccagttc
tgggccgccttcgacgccttcgtgccgggcacgccgctgttcaagtga

DBGET integrated database retrieval system