KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8114Help
Entry
bll8114           CDS       T00109                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bja00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    bll8114 (recR)
DNA repair and recombination proteins [BR:bja03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      bll8114 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(8906157..8906759)
Genome map
AA seq 200 aa AA seqDB search
MGAVAGPEIERLVQLLARLPGLGPRSARRAALHLIKKREALMMPLSSALQVALDKVQVCK
TCGNIDTQNPCTVCTDPKRDPAIIVVVADVADLWALERANATQGRYHVLGATLSPLDGVG
PQDLTIDALVARAHAAEVHEVILALNATVDGQTTAHYITDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggttgcaggtcccgaaatcgagcggctggtgcagcttctcgcacggctgccg
ggcctcggtccgcgctccgcgcggcgcgccgcgctgcatctgatcaagaagcgcgaagcg
ctgatgatgccgctgtcctcggccctccaggtcgcgctcgacaaggtccaggtctgcaag
acctgcggcaacatcgacacgcaaaatccctgcacggtctgcaccgatccgaagcgcgat
cccgcgatcatcgtggtcgtcgccgatgtcgccgacctctgggcgctggagcgggccaat
gcgactcaagggcgctatcatgtgctgggtgcgacattgtcgccgctcgacggcgtcggc
ccgcaggatctcaccatcgacgcgctggtcgcgcgcgcacatgctgccgaggtccacgaa
gtcatcctggcgctgaacgcgacggtcgacggccagaccacggcgcactacatcaccgac
ctgcttcaggacgccaacgtaaaagtaacccggctcgcccatggtgtgccggtcggcggc
gagcttgattatctcgatgaaggtacgctatcggccgcgatgcggcagcggaccctgttc
tag

DBGET integrated database retrieval system