KEGG   Bradyrhizobium japonicum USDA110: bll8114Help
Entry
bll8114           CDS       T00109                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bja  Bradyrhizobium japonicum USDA110
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bja03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(8906157..8906759)
Genome map
AA seq 200 aa AA seqDB search
MGAVAGPEIERLVQLLARLPGLGPRSARRAALHLIKKREALMMPLSSALQVALDKVQVCK
TCGNIDTQNPCTVCTDPKRDPAIIVVVADVADLWALERANATQGRYHVLGATLSPLDGVG
PQDLTIDALVARAHAAEVHEVILALNATVDGQTTAHYITDLLQDANVKVTRLAHGVPVGG
ELDYLDEGTLSAAMRQRTLF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggttgcaggtcccgaaatcgagcggctggtgcagcttctcgcacggctgccg
ggcctcggtccgcgctccgcgcggcgcgccgcgctgcatctgatcaagaagcgcgaagcg
ctgatgatgccgctgtcctcggccctccaggtcgcgctcgacaaggtccaggtctgcaag
acctgcggcaacatcgacacgcaaaatccctgcacggtctgcaccgatccgaagcgcgat
cccgcgatcatcgtggtcgtcgccgatgtcgccgacctctgggcgctggagcgggccaat
gcgactcaagggcgctatcatgtgctgggtgcgacattgtcgccgctcgacggcgtcggc
ccgcaggatctcaccatcgacgcgctggtcgcgcgcgcacatgctgccgaggtccacgaa
gtcatcctggcgctgaacgcgacggtcgacggccagaccacggcgcactacatcaccgac
ctgcttcaggacgccaacgtaaaagtaacccggctcgcccatggtgtgccggtcggcggc
gagcttgattatctcgatgaaggtacgctatcggccgcgatgcggcagcggaccctgttc
tag

DBGET integrated database retrieval system