KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8128Help
Entry
bll8128           CDS       T00109                                 

Definition
(RefSeq) helicase
  KO
K03579  
ATP-dependent helicase HrpB [EC:3.6.4.13]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     bll8128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(8919311..8921746)
Genome map
AA seq 811 aa AA seqDB search
MLDDLSRTLEAHNAAVLVAPPGAGKTTRVPLALLDAPWAKGKKIIVLEPRRIAARASADR
MAKSLGERAGETVGYRVRFGSKISRATRIEVVTEGIFTRQIMDDPELSGVAAVLFDEFHE
RSLDADMGLALARDAQTGLREDLRILVMSATLDGARVAKLLGEAPVVESEGRAFPVETRY
LGRKADAPIERQMADAIASALRADGGSVLAFLPGAAEIRRTQNFLGERVQDASIEIVPLF
GALDAAAQDRAIAPAPKGTRKVVLATSIAETSLTIEGVRIVVDSGLARVPRYEPDIGLTR
LETVRASRAAVDQRRGRAGRTEPGVCYRLWDEPQTASLAPYTQPEILSADLSSLVLDLAQ
WGVTDPAALSFLDPPPQPAWKEAKSLLSELNALDGDGRITAEGKSLRALALPPRLARMIV
DSHRAGAGGDAAEIAAILTERGLGGDSADLEHRRDQFRRDRSPRASSARDLARRWASQVA
ASEKEGPQEDLSTGLMLAYAFPDRVARNRGNGSFVLANGRGAAVEQTSSLARAPYIAIGE
MTGTAASGRILLAAQITEDDIERHFAEHIETVDEISFDRGAMALRARRKRALHAITLSEA
TLAVSPSEETARIFADGLIAAGLDRLPWSKAAEQWRDRVMFLRKAEGDSWPDLSDDGLIV
RRDDWLVPALYDKIALKDISAGDLSDALMALLPWEMRARLDREAPTHFEAPTGTVLAIDY
EAEQGPTIAVRLQELFGLNTHPSIAAGKVPLVLELLSPAQRPVQVTRDLPGFWRGSYAAV
RSDLRGRYPRHPWPEDPANALPTRRVKPRGT
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacgatttgtcgcgcacgctcgaggcacacaatgcggccgtgctggtggccccg
cccggcgccggcaagaccacgcgcgtgcctctggcgctgctcgatgcgccctgggccaag
ggcaagaagatcatcgtgctggagccgcggcgcatcgcggcgcgcgccagcgccgatcgc
atggccaaatcgctcggcgagcgggcaggtgagaccgtcggctaccgcgtccgtttcggc
tcgaaaatatcgcgcgcgacgcgcatcgaggtcgtgaccgaaggcatcttcacccgccag
atcatggacgatcccgagctctccggcgttgccgccgtcctgttcgacgaatttcacgag
cgttcgctcgacgccgacatgggccttgcgctggcgcgtgacgcgcaaaccggcctgcgc
gaggatctgcgcattctcgtgatgtcggcaacgctcgacggcgcccgcgtcgcaaagctg
ctcggtgaggcgcccgtcgtcgaaagcgagggccgcgcctttccggtcgagacgcgctat
ctcggccgcaaggcggacgcgccgatcgagcggcagatggcggatgcgatcgcctcggcg
ttgcgcgccgatggcggttcggtgctggcgttcctgcccggcgccgctgaaatccgccgc
acccagaatttcctcggcgagcgcgtccaggacgccagtatcgagatcgtgccgctgttc
ggcgcgctcgatgccgccgcgcaggatcgcgccattgcgcccgcgccgaagggcacgcgc
aaggtggtgctggcgacctcgatcgcggagacctcgctcaccatcgaaggcgtgcgcatt
gtcgtcgattccggtcttgcccgcgtgccgcgctacgagcctgatatcggcctgacccgg
ctcgagaccgtgcgcgcctcgcgcgcggcggtggatcagcgccgcggccgcgccggccgc
accgagccgggcgtctgctaccggctctgggacgagccgcagacggcgtcgctcgcgccc
tacacccagccggaaatcctcagcgccgatctgtcctcgctcgtgctcgatctggcgcaa
tggggcgtcactgaccccgccgcgctgtcgttcctcgacccgccgccgcagccggcctgg
aaggaagccaagagccttctcagcgagctcaatgcgctggatggcgacggccgcatcacc
gccgagggcaagagcctgcgcgcgctggcattgccgccgcggctggcgcgcatgatcgtg
gattcgcatcgcgccggcgcgggcggagacgccgccgagatcgcggcgatcctcaccgag
cgcgggctcggcggcgacagcgccgatctcgagcaccggcgcgaccagttccgccgcgac
cgctcaccgcgcgcatcgagtgcgcgcgaccttgcccggcgctgggcctcgcaggtcgcg
gcgtcagagaaggaggggccgcaggaagatctctcgaccggcctgatgctcgcctatgcc
ttcccggaccgcgtcgcgcgcaatcgcggcaacggcagtttcgtgctcgccaacggtcgc
ggcgccgccgtcgagcagacctcgtcgctcgcccgcgcgccctatatcgcgatcggcgaa
atgacgggcacggcggcgagcggccgcatcctgctcgccgcgcaaatcaccgaggacgac
atcgagcggcatttcgccgagcatatcgagaccgttgacgagatctcgttcgatcgcggc
gcgatggcgctgcgtgcacggcgcaagcgcgcgctgcatgcgatcacgctctctgaagct
acgctggctgtgtcgccgtcggaggagaccgcgcgcatcttcgcggatggtctgatcgcc
gcgggcctcgaccggttgccctggtcgaaggcggccgagcaatggcgcgaccgcgtgatg
ttcctgcgcaaggccgaaggcgacagctggcctgacctgtccgacgacgggctgatcgtg
cggcgcgacgactggctggtgcccgcgctctacgacaagatagcgctcaaggatatctcc
gccggcgatctctccgatgcgctgatggcgctgttgccgtgggagatgcgcgcacggctc
gaccgcgaggcgccgacgcatttcgaggcgccgaccgggaccgtgctcgcgatcgactac
gaggccgagcaggggccgaccatcgcagtgcggctccaggagttgtttggcctcaacacc
catccgtcgatcgcggccggcaaggtgccgctggtgctggaattgctgtcgccggcgcag
cgcccggtgcaggtgacgcgcgatctccccggtttctggcgcggcagctacgccgcggta
cgctccgacctgcgcggccgctacccgcgccatccctggccggaagatccggcgaatgca
ttgccgacccggcgggtcaaaccgcgcggcacctga

DBGET integrated database retrieval system