KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8133Help
Entry
bll8133           CDS       T00109                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Enzymes [BR:bja01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     bll8133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(8928861..8929487)
Genome map
AA seq 208 aa AA seqDB search
MTIELHTWNTPNGRKISVALEEMGLPYKVIPVNITKGEQMAPEFLKLSPNNKIPAIVDPE
GPDGKPVSIFESGAILLYLGEKTGKFLPKSLAGRIPVYEWLMWQMGGFGPMPGQVHHFIA
LENEQDRAYGLKRFMAETRRLYAVLDRRLADRDFVAGDLSVADFAILGWAWRHPRHKVEL
ADFPNVKRWYEALMARPAVKRGMDAKLD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgagctgcacacctggaacacgccgaacggccgcaagatctcggttgcgctg
gaggaaatggggctgccctacaaggtgatcccggtgaacatcaccaagggcgagcagatg
gccccggagttcctgaagctctcccccaacaacaagatccctgcgatcgtcgaccccgag
gggccggacggcaagcccgtcagcatcttcgaatccggtgcgatcctgctctacctgggc
gaaaagaccggcaaattcctgccgaaatcgctcgcgggtcgtatcccggtctacgaatgg
ctgatgtggcagatgggcggcttcggcccgatgcccggccaggtgcatcatttcatcgcg
ctcgagaacgagcaggaccgcgcctacggcctgaagcgcttcatggccgaaacccgccgg
ctctacgccgtgctcgaccgccggctggcggaccgcgacttcgtcgccggcgacctctcg
gttgccgattttgccatcctgggctgggcctggcgccatccacgccacaaggttgagctg
gccgacttccccaacgtcaagcgctggtacgaggccctgatggcgcggcctgcggtgaag
cggggcatggacgcgaagctggattga

DBGET integrated database retrieval system