KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8142Help
Entry
bll8142           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_10 CHAT TPR_7 TPR_1 TPR_2 TPR_8 TPR_16 TPR_17 TPR_4 TPR_19 TPR_14 TSA ODC_AZ TPR_3
Motif
Other DBs
NCBI-GeneID: 1048804
NCBI-ProteinID: NP_774782
RhizoBase: bll8142
UniProt: Q89BK6
Position
complement(8938336..8940963)
Genome map
AA seq 875 aa AA seqDB search
MSGSGLAARGFMTHRRLALAAGLALAITTSLATPGLAQKADLAAQGARINALNQAGKYAE
ALPLAQAMVASLEKGNDGRELSAALNNLGQVYAGQGRDDLAEPIYKRAIALMEKSLGLDT
TLIAPELNNLAALYQRQGRFTEAEPLFKRALAIREKALSREHPDVGQALNNLATLYVKQE
HFADAEPLFQRALAIYQKAAGPEHPAVATVLNNIGQVDRDLNRDADAEAPIKRSLAIREK
VLGPDHPDVARSLNNLAGLYEHQQRYANAEPLYRRALAIRERALGPDHPDVVTSTSNLAY
FLYVSGRTADALPLAERTLRSGRAQLRVVLPILFSARQQQLLSDDKALDEALAAIQRGTQ
SSAASAVNKLAVRLAAGSDRLAELVRKEQDLAAEAEALDKAIITAVSKQAAQRDVAAEQR
SRARIAAIASERAGLQKTLAVEFPDYASLSNPLPLGVKDIQPLLSADEAMTIYSVVDKQG
YVIAITREGVDWKEIPLGADALAQKVSAFRKGLDVGKAHDASGKSGLFDLALANELYVAL
LGPVEALTKDTRSLLVVPSAALTALPFHLLVTEKPQAAIPDKLEGYRNAAWLLRRQAVSV
LPSVISLKSLRAFARKDQGVKPMTGFGDPVFNPAAEGPADRRAASGKVAARSIATIAYTD
FWRGAGVDRARLAQALPQLPDTADELNAVARDVGAGDVDIHLGRDASETTLKRAALAQYS
IIYFATHGLVAGDVKGLGEPSLALSIPDQPTELDDGLLTASEVAQLKLNADWVVLSACNT
IAGDKPGAEALSGLARSFFYAGARALLVSHWAVDSEAATRLTTSTFALLKNEPGIGRAQA
LRRAMLTYLDDASSPRNAYPAMWGPFALIGEGDVR
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggttcgggattggcagcgagagggttcatgacgcatcgtcgtttggcgttggcc
gcgggtctggcgctcgcgatcaccacgtcgcttgccacccccggtcttgcccagaaggcc
gatctcgccgcacagggcgcgcggatcaacgcgctcaaccaggccggcaaatatgcggag
gcgctgcccctggcgcaggccatggtggcgagcctggagaagggcaacgacggccgcgaa
ctctccgccgcgctcaacaatctcggccaggtctatgccggccagggccgcgacgacctc
gccgagccgatctacaagcgcgcgatcgcgctgatggaaaagtcgctcggcctcgacacc
acattgatcgcgcccgagctgaacaatctcgccgcgctgtatcagcggcagggccgcttc
actgaagccgagccgctgttcaagcgtgcgctggccattcgcgaaaaggcgctgtcgcgc
gagcatcccgatgtcggccaggccctcaacaatctcgccacgctctacgtgaagcaggag
cattttgcggacgccgagccgctgttccagcgcgcgctcgcgatctatcagaaggccgcc
gggcccgagcatcccgcggtcgccacggttctgaacaacatcggtcaggtcgatcgcgac
ctcaaccgcgatgcggatgccgaggcgccgatcaagcgctcgctcgcgatccgcgaaaag
gtgctgggtccggatcatcccgacgtcgcgcgttcgctgaacaatctcgccgggctctac
gagcaccagcagcgttatgccaatgccgagccgctctaccggcgcgcccttgcgatccgc
gagcgcgcgcttgggccggaccatcctgacgtcgtgacctcgaccagcaatctcgcttat
ttcctttatgtctccgggcgcactgccgatgccttgccgctggcggaaaggacgcttcgc
agcggccgcgcgcagctgcgtgtggtgctgccgatcctgttttccgcgcggcagcagcag
ctcctctccgacgacaaggccctcgacgaagcgctggccgcgatccagcgcggcacgcaa
tcgtccgccgcatccgccgtgaacaagctcgcggtgcggcttgcggccggcagcgaccgg
ctcgccgagctcgtgcgcaaggagcaggatctcgcggccgaggccgaggcgctcgacaag
gcgatcattacggcggtgtccaagcaagccgcgcaacgcgacgtcgcggccgagcagcgc
agccgcgcgcggatcgcggcgatcgcgagcgagcgcgccggcttgcagaagacgctcgcc
gtcgagtttcccgactatgcctcgctgtccaatccgctgccgctcggcgtgaaggacatc
cagccgttgctgtcggccgacgaggcgatgacgatctattccgtcgtggacaagcagggc
tatgtcatcgcgatcacgcgcgagggcgtcgactggaaggagattccgcttggcgcggac
gcgctggcgcagaaagtgtcggcgttccgcaaagggctcgacgtcggcaaggcacacgat
gcgtccggcaaatccggcctgtttgacctcgcgctcgccaatgagctctatgtcgcgctg
ctcggcccggtcgaagcgctgacgaaagacacgcgcagcctgctggtggtgccctcggcc
gcactgaccgcactgccgtttcatctgctcgtcaccgagaagccgcaagctgcgatcccg
gacaagctcgaaggctatcgcaacgccgcctggctgttgcggcgtcaggccgtctcggtg
ctgccgtcggtgatcagcctgaaatcgctgcgggcctttgcgcgcaaggatcagggcgtc
aagccaatgaccggctttggcgatcctgtgttcaaccctgcagccgaagggccggccgat
cgtcgcgccgcaagcggcaaggtcgccgcgcgcagcatcgcgacgattgcctataccgac
ttctggcgcggcgccggcgtcgatcgtgcgcggcttgcgcaagcgctgccgcaactgcct
gacactgccgacgaactgaacgcggtggccagggatgtcggcgcaggcgatgtcgatatc
catcttggccgcgacgccagcgaaacgacgctcaagcgtgcagcgcttgctcaatacagc
atcatttactttgccacccacggcctcgttgcgggcgacgtcaagggactgggcgagcct
tcgcttgcgctctccattccagatcagcctacggagctggacgacggtttgctgacggcg
agcgaagtcgcccagctcaagctcaatgcggattgggtggtgctgtcggcctgcaacacc
atcgccggcgacaagcccggcgcagaggccctgtcgggattggcgcgctcgttcttctat
gccggtgcccgcgcgctcctggtctcgcattgggcagtggattcggaagctgccacccgc
ttgaccacgtcgacattcgctctgctcaaaaacgaaccaggaatcggtcgtgcccaagcg
ttgcgccgcgccatgttgacgtatctcgacgacgcctcgtcgccgcgcaacgcctatcct
gcgatgtggggaccgttcgcactgatcggcgagggagacgtacgatag

DBGET integrated database retrieval system