KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8168Help
Entry
bll8168           CDS       T00109                                 

Gene name
cvrA, nhaP2, ycgO
Definition
(RefSeq) potassium/proton antiporter
  KO
K11105  
cell volume regulation protein A
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Brite
Transporters [BR:bja02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   bll8168 (cvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(8968199..8969992)
Genome map
AA seq 597 aa AA seqDB search
MASLDSVSLAILLGAVLVMAGILSSLLALRFGAPLLLVFLVIGMLAGDSGPGQIQFDDVR
TTYLVGSVALALILFDGGLKTRFASIRTVLAPSVVLATVGVLLTALITAPFAKYALDLNW
TESLLVGAVVASTDAAAVFLLVHTQGLRLRPRVGATLEAESGTNDPFAIFLTLMLVEYIS
LGSSSAGHVLMEFLQEAVLGAVVGFFGGRLVVIALNQVALPQGLHAPFVTTGALVIFGGS
QIMHASGFLAVYLAGIIIGNRPTRAHNSVVTFLDAATWLAQIVMFVLLGLLVSPSRLGAS
VLPAVAVALVLMLVARPLAVFVCLAPFRFNWRERIFIAWTGLRGAVAIFLASIPMLVGLS
KAYLYFDVAFVVVIISLLLQGWTLAPAARKLHVALPRAERGPRRVELDLPGQLEQQLVGY
PVQSKSLYFRRGLIPSWSKPTLVIRNENILTPTEADPIAPGDYIYLLAPPEKAESLDRFF
VDMQPSTAPDPHLLGDFMVSGEHTLAELAEIYGVKVSEDEGKLTLADYFDVHLDRAPKEG
AELALDEIVLVARSISGGRVNVVGLRLPEDEETPAPLTRWQALRRKLAELWTSVAGV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcctctctcgactctgtcagcctcgccatattgctcggcgccgtcctggtgatggcg
ggtatcctgtcgagcctgcttgcgctgcgcttcggcgcgcccttgctgctcgtcttcctt
gtgatcggcatgctcgcgggcgattccggtcccgggcagatccagttcgacgacgtccgc
accacctatctggtcggctcggtggcgctggccctgatcctgttcgacggcggcctgaag
acgcgctttgccagcatccgcaccgtgcttgcgccatccgtggtgctcgcgaccgtcggc
gtgctgctgaccgcgctgatcacggcgccgttcgccaaatacgcgctcgacctcaactgg
acggagtcgctgctggtcggcgccgtggtagcctcgaccgatgcggccgccgtgttcctg
ctggtccatacccagggcctgcgcctgcgtccgcgcgttggtgcgacgctggaggccgag
tccggcaccaacgaccccttcgcgatcttcctcaccctgatgctggtcgaatacatctcg
ctgggatcgagctcggcggggcacgtgctgatggagttcctgcaggaggcggtgctgggc
gccgtcgtcggcttcttcggcggacgtctcgtcgtcatcgcgctcaaccaggtggcgctg
ccgcagggcctgcatgcgccgttcgtgaccacaggcgcgctcgtgatcttcggcggctcg
cagatcatgcatgcctcgggcttcctcgcggtctatctcgccggcatcatcatcggtaac
cggcctacgcgcgcgcataattcggtggtgaccttcctcgatgccgcgacctggctggcg
cagatcgtgatgttcgtgctgctcggtctcctggtctcgccgagccggcttggcgccagc
gttttgccggctgttgccgtcgcgctcgtgctgatgctggtcgcacggccgctcgcggtg
ttcgtctgcctggcgccattccgcttcaactggcgcgaaaggatcttcatcgcctggacg
ggcctgcgcggtgccgtcgcgatcttcctggcgtcgatcccgatgctggtcggcctgtcc
aaggcctatctctatttcgacgtcgctttcgtcgtcgtcatcatctcgctgctcttgcaa
ggctggaccctggcgccggccgcacgcaagctgcacgtcgcgctgccgcgcgccgagcgc
ggcccgaggcgtgtcgaactggatctgcccggccagctcgagcagcagctcgtcggctat
ccggtgcaatccaagagcctgtacttccgccgcggcctgatcccgtcctggtcgaagccg
acgctggtgatccgcaacgagaacattctgacgccgacggaggccgatccgatcgcgccc
ggcgactacatctatctgctggcgccgccggaaaaggccgagtcgctcgaccgcttcttc
gtcgacatgcagccgagcaccgcgccggacccgcatctgctcggcgacttcatggtctcc
ggcgagcacacgctggccgagctcgccgagatctatggcgtgaaggtgagcgaggacgaa
ggcaagctgaccttggccgactatttcgacgtccatctcgaccgcgcgccgaaagagggc
gccgagcttgcgctggacgagatcgtgctggtcgcacgcagcatctccggcggccgcgtc
aacgtcgtgggcctgcgcctgccggaagacgaggaaacgcccgcgccattgacgcgctgg
caggcgctgcgccgcaagctggcggagctgtggacctcggtggcgggggtttag

DBGET integrated database retrieval system