KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8178Help
Entry
bll8178           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 DUF4376
Motif
Other DBs
NCBI-GeneID: 1048586
NCBI-ProteinID: NP_774818
RhizoBase: bll8178
UniProt: Q89BH4
Position
complement(8981698..8982564)
Genome map
AA seq 288 aa AA seqDB search
MCRSDSGRLPHAARLPHVNFESSNTRDEVEMRKVVPNGKAVKALREQLERLSTQKEMASE
IGVSIRMLRMIENENAPIAVTTAERLAKALQVHRERIILGSELSEMTPTVSAPEVLSALM
EDEDRLIPRNDYDIASATADEGALYTEAARSHDVACIIETTLDEETGAYAQELFDILVGL
SWSQRDILVDIPPATEIAVRRRLRQLIVLLKGNDIWIYRTSVLRRLPERYTVAPPDEPFS
YQSRQVVALGPPGEYGETTMRVPIDHGQPFILPAWRKLRKSDNETETA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccgctccgattccggtcggctgcctcacgctgccaggctccctcatgtaaatttt
gagtcatcgaatacacgggatgaggttgagatgaggaaggtcgtgccgaacgggaaggcg
gtgaaagccctgagggagcagcttgaaaggctgtcgacccaaaaggaaatggcgagtgaa
atcggtgtcagcattcgcatgcttcgtatgatcgagaatgagaatgcgccaattgcagtg
acaacggctgaacggttggcaaaagcgctgcaagttcatcgtgaacgcattatccttggc
tccgagctttcggaaatgacgccgaccgtaagtgcgccggaagtcctttccgcgctgatg
gaagatgaggaccggctcatcccccgcaacgactatgacatcgccagtgcgacagcggac
gagggcgcgctctatacggaggcggcccgctcgcacgacgtggcctgcattatcgagaca
acgctcgatgaggaaactggagcctatgcgcaggagcttttcgatatcctcgttggcttg
tcctggtcgcagcgagatattctcgtcgacattccccccgcgacggagatcgcggttcgc
cggcgcctgcgacagctcatcgtccttctcaagggcaacgacatctggatttatcgaacc
tcggttctgaggcgattgccggagcgctacacggtcgcaccgccggacgagccgttctcc
tatcaaagccgtcaggtcgtagcactagggccgccgggtgaatatggcgagaccaccatg
cgcgtgccgatcgatcatgggcagccgttcatccttccggcatggcggaagcttcgcaag
agcgacaacgaaacagagacagcctga

DBGET integrated database retrieval system