KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8239Help
Entry
bll8239           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
  KO
K07483  transposase
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_28 HTH_29 HTH_23
Motif
Other DBs
NCBI-GeneID: 1048224
NCBI-ProteinID: NP_774879
RhizoBase: bll8239
UniProt: Q89BB9
Position
complement(9029116..9029514)
Genome map
AA seq 132 aa AA seqDB search
MEQSGEEAEADGFVGKLTRRTRSGCRLWSAEIKGRAVFESMKPDARVCDVARRYGVKAQQ
LTTWRRLARAGRLALVTDDAADFVSIELSDPVASGKSEGPVEITIGKVSVRLDADVSAVR
IAEIVTAIERGA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatcgggggaggaagccgaagctgatggctttgtggggaagcttacgcgccgg
acgcgttctggatgccggttatggtctgcggagatcaaggggcgcgctgttttcgagagc
atgaagcccgacgcccgggtatgtgatgtcgcacggcgttatggtgtgaaggcccagcag
ttgacgacgtggcgcagattggcgcgtgctggccggctcgcattggtcacggacgacgcg
gcggatttcgtgtcgatcgagctgagcgatccagtggcgtcaggcaagagcgaggggccc
gtcgagattacgattggcaaggtttcggtccgcctggatgcggacgtgtcggcggtgcgg
atcgcggagatcgtgactgcgatcgagcgcggcgcatga

DBGET integrated database retrieval system