KEGG   Bradyrhizobium diazoefficiens USDA 110: bll8244Help
Entry
bll8244           CDS       T00109                                 

Definition
(RefSeq) hypothetical protein
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(9032323..9036648)
Genome map
AA seq 1441 aa AA seqDB search
MDFPLTKSVHEQSGSTGPQESSPAAPSAAAATFERQLREISSSGVGGGAMPAAAALQPAQ
STEVLIGRQCNQILYSEDARLISGLEKALTKGGAAKGTTNNYLRVLRGFGHWLSANNKKG
ISARLDDKKSLSQDAREFSGEGEPWKLLTAIGHLRNSQSTGEVVPITRHVEVNPYQQDAE
LIKEYQNEVASEMGKRDATALRNFSDYLRDNNKKGIVGRLRGELLNEDVKSYKKVSAFRS
KIGVALDRLRKSSAGAKAMDLERNIDPEDAALKESRQVGDAAAQHSSSQKAGSWPEELLP
AEGHDQNLLLGPMDEPGASSSAPQPTQSTGILRGRRRRPLYPEDAALISGLEKALIKGGA
AEGTAKDHVRTLLSFGQRLYANNKDPIAARLDDEKSLTADARELFEKRPATLHRAIDHLR
TSRSTGGIVPIAGRTELHPYPQDAALIKEYKNEVATDAGKRDATALRNFSDYLRDNNRPG
IAAGLGTSFDGDVESYRKVAGADSRIGAALARLRKSQAGAEAMEHERHIDPEEAALRESR
RVGDAAAQHIASQKGGSWPEELLPAEGHDQDLLLGLMDEPGPSSSAPQSAQSTWIVIGKR
KQPLYSVDAPLISGLERALIKGGFSKSAAEQHGGSLRSFSRWLFAKEKPSIRDRLDNKSL
TDGGEVLEFTGEGNPKRLVQAIDYLRTLRSTGEVPISRRAKLNPHPQNVAFINPEDTVLM
EPRRVDAAAAQHSASQETGRRPEELPAEGRDQDLLLGLMDEPRSSSSLEPAARHDQAPDP
GEPDRQQSPDEPMAALARSNRLPSEEVLINDEHDTAELRPAKRQRTLNNPQGVAGERQLS
EIANSGGQPTPAPTHQQGTSSWETQPMLLRSGYEDVTAPHAVAMYVGGAAAQHSARQRAV
SRPLVLPEGYDQDLRLMVEDGPSWPEVPPEQAQDIVQAGQEPARPTVEAAPTHSARARSN
TYGGIEVSFNPNSPASFELRDNAWSPAPGFPPPFAGPVPGHHQGAQQLGSPQGLSPVSAH
SDDDALAWLSEELARQMQEPASPSTARAQDLYRGFEALLDPDVAELDDSAHFAPAPSARA
CSDTYGGLEVSFNPNSPTSFELRDNAWSRAPGFPPPFAGPVPGHHQGARQLGSPQGLSPV
SAHSDDDALAWLSEELARQMQEPASPSTARAQDLYRGFGALLDPDAAELDDSAHFAPAPS
ARARSDTYDGLPLVDLTAPAPSPLRDDIVRRFPITSSDAQIGALNPIALSHNRGLVLEDT
EWLGDEHILRDYQLQELDLQRSDSDLAARTRFVDPLEALRLRLGAESDVLRVFHRIVHDR
RDNDTADFLLLPVNDASATDRGRHWSLLFVDRSNRQRPVAYHYDSYGRYNETHARQLAER
LNLALQPAGMAQQQNTCDCGVFVVDGTRELVRQLAQGREPDQLNLSNVVANRQALQARLR
G
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atggatttccccttgaccaagtcggtgcatgaacaatcgggcagcacgggtccgcaagag
agctcacccgcggctccgtctgcagccgcggcgacctttgagcggcaattgagagagatc
agcagttcaggtgtgggtggtggagcaatgccggccgccgctgcgctgcagccggctcaa
tcaacggaggttttgatagggaggcagtgcaatcagatcctttactccgaggatgctcgc
cttatctcggggcttgagaaggcccttacgaagggcggggccgccaaaggcaccaccaat
aactatttacgtgttcttcgcggctttggccattggctctccgcaaataacaaaaagggc
atctctgctcggctcgacgacaaaaaatcgctgtctcaagatgcgcgcgagttcagcgga
gagggtgagccctggaaacttcttacagcaataggtcatctccgaaattcgcagtcgacc
ggcgaagtcgtgccgatcacacgccacgttgaggtaaatccttatcagcaggacgcggaa
ctcatcaaagagtaccaaaacgaagtagcgtcagagatgggcaagagggatgcaaccgct
cttcgcaatttcagcgactacctgcgtgacaacaacaagaagggtattgttggtcggctt
cgcggcgagttgttaaatgaagatgttaagagctataagaaagtctccgcttttcgttcg
aaaatcggtgtcgcgctggatcgtctccgaaaatcgtcggccggcgctaaggcgatggat
ctcgagcgcaatattgatcccgaagacgcggccctgaaggagtcgaggcaggtcggcgac
gccgctgcgcagcacagttcgtcgcagaaagctggcagttggccagaggaattgcttcct
gcggaaggccatgatcagaatttgcttttggggccgatggacgaacccggcgcgtcgtcc
tcggcgccgcagccgactcagtcaactgggattttgagagggaggaggagacggcctctt
tatcccgaggatgctgcccttatttcggggcttgagaaggccctcatcaagggcggggcc
gccgaaggcaccgccaaggaccatgtacgtactcttctcagctttggccagaggctctac
gcaaataacaaagatcccattgctgctcggctcgacgacgaaaagtcactgaccgctgat
gcgcgcgagttgttcgaaaagcgtcccgcgacactccatagggcaatagaccatctcagg
acctcgcggtcgacgggcggaatcgtgccgatcgcaggccgcactgagttgcatccttat
ccccaggacgcggcactcatcaaagagtacaaaaacgaagtagcgacagatgccggcaag
agggatgcaactgctcttcgcaatttcagcgactacctgcgtgacaacaacaggccgggc
attgctgctgggctcggcacgtcgtttgatggagatgtcgagagctataggaaggtcgcc
ggtgctgattccaggattggtgccgcactggctcgtctccgaaaatcgcaggccggcgct
gaggcgatggagcacgagcgccatattgatcccgaagaggcggccctgagggagtcgagg
cgggtcggcgacgccgctgcgcagcacattgcgtcgcagaagggtggcagttggccagag
gaattgcttcctgcggaaggccatgatcaggatttgcttttggggctgatggatgaaccc
ggcccgtcgtcctcggcgccgcagtcggctcagtcaacttggattgtgatagggaagagg
aagcagcctctttattccgtggatgctccccttatttcggggcttgagagggccctcatc
aagggcgggttcagcaaatccgctgccgagcagcacggaggttcccttcgtagctttagc
cgttggcttttcgcaaaagaaaaaccgagcattcgtgatcggctcgacaataagtcgctg
accgatggcggtgaggtgctcgagttcaccggagagggtaatccaaagagactcgttcag
gcaatcgactatctccggaccttgcggtcgacgggcgaagtgccgatctcacgacgcgct
aagctgaatcctcacccccagaacgtggcctttatcaatcccgaagacacggtactgatg
gagccgaggcgcgtcgacgccgccgctgcgcagcacagcgcgtcgcaggaaactggccgt
cggccagaggagcttcccgcggaaggccgcgatcaggatttgcttttggggctgatggac
gaaccccgctcgtcgtcatctctcgagccagccgcgcgccatgaccaggcaccggatccc
ggagagcccgaccgccagcagtccccggacgagccgatggctgcgcttgccaggagcaac
cgcctgccaagcgaggaggtcctcatcaacgatgagcatgacacagctgagttgaggcca
gcgaagaggcagaggaccctaaacaatccgcaaggcgttgccggcgagcggcagctgagc
gagatcgccaattcaggcggccagccgacaccggcgcctacccatcaacagggtacgtcg
tcatgggagacgcagccgatgctgctgcggagcggctacgaagatgtcacggcgccgcat
gcggtcgcgatgtacgtcgggggcgccgctgcgcagcacagcgcgcggcagcgagctgtc
agtcggccattggtcctcccggaaggttacgatcaggatctgcgcttaatggtggaagac
ggcccatcgtggcccgaggttcctcctgagcaggcgcaggacatagtccaagctgggcag
gaacctgcccggccgaccgtggaagcagcgccaacgcactctgccagggctcgctcaaat
acctacggcggtattgaggtgtcgtttaatccgaattcgcccgcatcatttgagttgcgt
gacaatgcttggagcccggcgcctggctttccgccgccgtttgccgggccggtaccgggg
catcaccagggcgctcaacagctcggctcgccgcaggggctttctccggtgtccgcccac
tcggacgatgacgctttggcgtggttgagcgaggagcttgcgcggcagatgcaagaaccg
gcatcaccatcaactgccagggctcaggatctctatcgtggatttgaggcactccttgat
ccggatgtggccgagttggatgacagtgctcactttgcgccagcgccttctgccagggct
tgctcagacacctacggcggtcttgaggtatcgtttaatccgaattcgcccacatcattt
gagttgcgcgacaatgcttggagccgggcgcctggctttccgccgccgtttgccgggccg
gtaccggggcatcaccagggcgctcgacagctcggctcgccgcaggggctttctccggtg
tccgcccactcggacgatgacgctttggcgtggttgagcgaggagcttgcgcggcagatg
caagaaccggcatcaccatcaactgccagggctcaggatctctatcgtgggtttggggca
ctgcttgatccggatgcggccgagttggatgacagtgctcactttgcgccagcgccttct
gccagggctcgttcagacacctacgacggtcttccattggttgatctgaccgcgcccgca
ccgtccccattgcgcgacgatatcgtgcggcggtttccgatcacctcctccgatgctcag
atcggggcgttgaatccgatagccttgtcccataaccgcgggctggtgctcgaggacacg
gaatggctgggcgacgagcatatcctcagggattaccagcttcaggagctggatttgcag
aggagcgattcggatctcgccgcccggacgcggttcgtagatcccctcgaagcgctgcgg
ctgcgcctgggcgcggagagcgacgtgctacgcgtattccatcgcatcgtccatgatcgg
cgtgataacgatacagccgacttcctgttgctgccagtgaacgatgccagtgctacggac
cgcggcaggcattggtcgctgctgttcgttgatcgcagcaaccggcaacggcctgtcgcc
tatcactacgattcctacgggagatacaacgagacgcatgcaagacaactcgcagaaagg
ctgaacctcgccctgcagcccgccggcatggcccagcagcagaacacttgtgattgcggc
gtctttgtcgtggacggcacgcgggagctggttaggcaattggcgcaaggacgggagcca
gaccagctgaacctcagcaacgtcgttgccaatcggcaggcactgcaagcgcgactcagg
ggttga

DBGET integrated database retrieval system