KEGG   Bradyrhizobium diazoefficiens USDA 110: blr0107Help
Entry
blr0107           CDS       T00109                                 

Definition
coenzyme A ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bja  Bradyrhizobium diazoefficiens USDA 110
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bja00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    blr0107
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    blr0107
   00620 Pyruvate metabolism
    blr0107
   00640 Propanoate metabolism
    blr0107
  Energy metabolism
   00680 Methane metabolism
    blr0107
Enzymes [BR:bja01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     blr0107
Lipid biosynthesis proteins [BR:bja01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   blr0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
104748..106361
Genome map
AA seq 537 aa AA seqDB search
MSNEICDQVPADSAGAREIGFAVPEIYNASRVLFDNLGKGYGDKLALIGPAGTRTYAELC
AEACRWGNGFISLGLKRGDRVLLFLDDTPAYPAAFFGAVRAGFVPLLINTLTPPDLLQFY
LADSGATVAVAESEFCARFNAEARKDTSLRTLIVVNGEMGERAAPAAVAAASWLAQFPAE
LAEANTHRNEMAFWMYSSGSTGRPKGIVHLQHDMTYSEVAFAQNVLKLTPDDICFSVPKI
FFAYGFGNSVTFPFSVGAATLLLPGQPKPATIFAAIEQYRPTVFFGLPTLYTSLTKAEGA
QQTNFSSLRMALSAAEVLSAEVFNGWKTLTGLEIVEGLGSTEVLHIYLSNRPERKKLGAA
GLRVPGYEVALRNKDGSEVGDGEEGILWVRGDSNTPLYWNRPDKSAETIREGGWIYTGDR
FVRDADGFHFFRGRADDLIKISGQWVYPLEVELCLADHPDIRECAVFAAELPDRRMTLKA
VVVMNSRTTDQGEATRRLQDYVKGKLLPYKYPREVIFIDELPKTGTGKIDRQALLRM
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgagatttgcgaccaggtgcccgcggacagcgcgggcgcacgcgagatcggc
tttgccgttccggaaatctacaacgccagccgcgtgctgttcgacaatctcggcaaggga
tatggcgacaagctcgcgctgattggtccggcgggcacgcgcacatatgccgagctctgc
gcggaggcttgccgctggggcaacggcttcatctcgctcggcctcaagcgtggcgatcgc
gtgctgctgttcctcgacgatacgccggcttatcccgccgccttcttcggcgccgtgcgt
gccggcttcgtgccgctcctgatcaacacgctgacgccgccggatctgttgcaattctat
ctcgccgattccggcgcgaccgtcgcggtggccgagtccgaattctgcgcgcgcttcaat
gcagaggcgcgcaaggacacgagcctgcgtacgctgatcgtcgtcaatggcgaaatgggc
gagcgtgctgcgcctgcggcggtcgcggcggcaagctggcttgcgcaattcccggccgag
cttgcggaagcgaatacccatcgcaacgagatggcgttctggatgtactcgtccggctcg
accggccggcccaagggcatcgtgcacctccagcacgacatgacctatagcgaggtggcc
ttcgcgcagaatgtgttgaagctgacgcctgacgacatctgcttctcggtgccgaagatc
ttctttgcctacgggttcggcaactccgtcaccttcccgttctcggtcggcgcggcgacg
ctgctgctaccgggacagccgaagccggcgacgatcttcgcggcgatcgagcaatacagg
ccgaccgtcttcttcggcctgccgacgctttacacctcgctgaccaaggccgagggcgcg
caacagacgaacttctcgtcgctgcgcatggcgctctccgcagccgaagtgctctcggcc
gaagtcttcaacggctggaagacgctcacggggctcgaaatcgtcgaaggcctcggctcg
accgaggtgctgcacatctatctctccaaccgtcccgaacggaagaagctcggcgccgcg
ggcctgcgcgtgcccggctacgaggtcgcgctgcgcaacaaggacggaagcgaggtcggc
gacggcgaggaaggcatcttgtgggtgcgcggcgattccaacacgccactgtactggaat
cggccggacaagtccgccgagaccatccgcgagggcgggtggatctacaccggcgaccgc
ttcgtccgcgatgccgacggcttccacttcttccgcggccgcgccgacgatctcatcaag
atctccggccagtgggtctatccgctcgaggtcgagctctgcctcgccgatcaccccgac
atccgcgaatgcgcggtgttcgccgccgagctgccggaccgtcgcatgacgctgaaggcg
gtggtggtgatgaacagccgcaccaccgaccaaggcgaagcgacgcggcggctacaggat
tacgtgaagggcaagctcttgccctacaaatatccgcgcgaggtgatcttcatcgacgaa
ctgccgaagacggggacggggaagatcgaccggcaggcgttgctgcggatgtga

DBGET integrated database retrieval system